Tested Applications
| Positive WB detected in | Raji cells, Ramos cells |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29601-1-AP targets RELB in WB, IHC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30334 Product name: Recombinant human RELB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 375-446 aa of BC028013 Sequence: VTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDHFL Predict reactive species |
| Full Name | v-rel reticuloendotheliosis viral oncogene homolog B |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 62-65 kDa |
| GenBank Accession Number | BC028013 |
| Gene Symbol | RELB |
| Gene ID (NCBI) | 5971 |
| RRID | AB_2918330 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01201 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RELB is one of the more unusual members of the NF-κB family, it is best known for its roles in lymphoid development, DC biology, and noncanonical signaling. RELB is capable of direct binding to the AhR that supports the xenobiotic-detoxifying pathway. RELB can regulate the circadian rhythm by directly binding to the BMAL partner of CLOCK.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RELB antibody 29601-1-AP | Download protocol |
| IP protocol for RELB antibody 29601-1-AP | Download protocol |
| WB protocol for RELB antibody 29601-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





