Tested Applications
Positive WB detected in | Raji cells, Ramos cells |
Positive IP detected in | Raji cells |
Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
29601-1-AP targets RELB in WB, IHC, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30334 Product name: Recombinant human RELB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 375-446 aa of BC028013 Sequence: VTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDHFL Predict reactive species |
Full Name | v-rel reticuloendotheliosis viral oncogene homolog B |
Calculated Molecular Weight | 62 kDa |
Observed Molecular Weight | 62-65 kDa |
GenBank Accession Number | BC028013 |
Gene Symbol | RELB |
Gene ID (NCBI) | 5971 |
RRID | AB_2918330 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q01201 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RELB is one of the more unusual members of the NF-κB family, it is best known for its roles in lymphoid development, DC biology, and noncanonical signaling. RELB is capable of direct binding to the AhR that supports the xenobiotic-detoxifying pathway. RELB can regulate the circadian rhythm by directly binding to the BMAL partner of CLOCK.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RELB antibody 29601-1-AP | Download protocol |
IHC protocol for RELB antibody 29601-1-AP | Download protocol |
IP protocol for RELB antibody 29601-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |