RELB Polyclonal antibody, PBS Only

• 

  WB analysis using 29601-1-AP (same clone as 29601-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29601-1-AP (RELB antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29601-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Raji using 29601-1-AP (same clone as 29601-1-PBS)

  IP result of anti-RELB (IP:29601-1-AP, 4ug; Detection:29601-1-AP 1:1000) with Raji cells lysate 2840 ug. This data was developed using the same antibody clone with 29601-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 29601-1-AP (same clone as 29601-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 29601-1-AP (RELB antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29601-1-PBS in a different storage buffer formulation.

RELB Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 29601-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Transcription factor RelB, I-Rel

---

Product Information

29601-1-PBS targets RELB in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30334

  Product name: Recombinant human RELB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 375-446 aa of BC028013

  Sequence: VTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDHFL

• Full Name: v-rel reticuloendotheliosis viral oncogene homolog B
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 62-65 kDa
• GenBank Accession Number: BC028013
• Gene Symbol: RELB
• Gene ID (NCBI): 5971
• RRID: AB_2918330
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01201
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RELB is one of the more unusual members of the NF-κB family, it is best known for its roles in lymphoid development, DC biology, and noncanonical signaling. RELB is capable of direct binding to the AhR that supports the xenobiotic-detoxifying pathway. RELB can regulate the circadian rhythm by directly binding to the BMAL partner of CLOCK.