RFX4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86413-1-RR (same clone as 86413-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86413-1-RR (RFX4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86413-1-PBS in a different storage buffer formulation.

RFX4 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86413-1-PBS

Clone No.250936D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

NYD SP10, Testis development protein NYD-SP10

---

Product Information

86413-1-PBS targets RFX4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4119

  Product name: Recombinant Human RFX4 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 140-190 aa of BC030644

  Sequence: YYDVMYSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLP

• Full Name: regulatory factor X, 4 (influences HLA class II expression)
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 84 kDa
• GenBank Accession Number: BC030644
• Gene Symbol: RFX4
• Gene ID (NCBI): 5992
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q33E94
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RFX4, also named as NYD-SP10, contains one RFX-type winged-helix DNA-binding domain and belongs to the RFX family. It may activate transcription by interacting directly with the X-box. The protein is structurally related to regulatory factors X1, X2, X3, and X5. It has been shown to interact with itself as well as with regulatory factors X2 and X3, but it does not interact with regulatory factor X1.