RFX4 Recombinant monoclonal antibody

• 

  WB analysis using 86413-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86413-1-RR (RFX4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

RFX4 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86413-1-RR

Clone No.250936D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

NYD SP10, Testis development protein NYD-SP10

---

Tested Applications

• Positive WB detected in: HT-29 cells, mouse brain tissue, rat brain tissue, fetal human brain tissue, mouse testis tissue, rat testis tissue, human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86413-1-RR targets RFX4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4119

  Product name: Recombinant Human RFX4 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 140-190 aa of BC030644

  Sequence: YYDVMYSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLP

• Full Name: regulatory factor X, 4 (influences HLA class II expression)
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 84 kDa
• GenBank Accession Number: BC030644
• Gene Symbol: RFX4
• Gene ID (NCBI): 5992
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q33E94
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RFX4, also named as NYD-SP10, contains one RFX-type winged-helix DNA-binding domain and belongs to the RFX family. It may activate transcription by interacting directly with the X-box. The protein is structurally related to regulatory factors X1, X2, X3, and X5. It has been shown to interact with itself as well as with regulatory factors X2 and X3, but it does not interact with regulatory factor X1.