RGS14 Monoclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 67394-1-Ig (same clone as 67394-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67394-1-Ig (RGS14 antibody) at dilution of 1:13000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67394-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67394-1-Ig (same clone as 67394-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67394-1-Ig (RGS14 antibody) at dilution of 1:13000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67394-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67394-1-Ig (same clone as 67394-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67394-1-Ig (RGS14 antibody) at dilution of 1:13000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67394-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67394-1-Ig (same clone as 67394-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67394-1-Ig (RGS14 antibody) at dilution of 1:13000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67394-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67394-1-Ig (same clone as 67394-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67394-1-Ig (RGS14 antibody) at dilution of 1:13000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67394-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67394-1-Ig (same clone as 67394-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67394-1-Ig (RGS14 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67394-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67394-1-Ig (same clone as 67394-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67394-1-Ig (RGS14 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67394-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67394-1-Ig (same clone as 67394-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RGS14 antibody (67394-1-Ig, Clone: 1C1B2 ) at dilution of 1:2000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 67394-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67394-1-Ig (same clone as 67394-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.4 ug RGS14 Monoclonal antibody (67394-1-Ig, Clone:1C1B2) and CoraLite488-conjugated Donkey Anti-Mouse IgG(H+L)( SA00013-5)(red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 67394-1-PBS in a different storage buffer formulation.

RGS14 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 67394-1-PBS

Clone No.1C1B2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

1C1B2, Regulator of G-protein signaling 14

---

Product Information

67394-1-PBS targets RGS14 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9477

  Product name: Recombinant human RGS14 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 217-566 aa of BC014094

  Sequence: KSLPLGVEELGQLPPVEGPGGRPLRKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPGEKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPSSLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNSTTDSAL

• Full Name: regulator of G-protein signaling 14
• Calculated Molecular Weight: 566 aa, 61 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC014094
• Gene Symbol: RGS14
• Gene ID (NCBI): 10636
• RRID: AB_2882638
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43566
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RGS14, a member of the R12 subfamily of RGS proteins, is highly expressed in the brain and is a natural suppressor of CA2 hippocampal synaptic plasticity and learning and memory. RGS14 was first identified as a complex scaffolding protein with an unconventional domain structure that allows it to interact with various protein binding partners. RGS14 contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. The protein attenuates the signaling activity of G-proteins by binding, through its GoLoco domain, to specific types of activated, GTP-bound G alpha subunits. Acting as a GTPase activating protein (GAP), the protein increases the rate of conversion of the GTP to GDP.