RGS14 Monoclonal antibody

RGS14 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 67394-1-Ig
Clone No.1C1B2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

1C1B2, Regulator of G-protein signaling 14

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, HeLa cells, HEK-293 cells, Jurkat cells, NIH/3T3 cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:15000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67394-1-Ig targets RGS14 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9477

Product name: Recombinant human RGS14 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 217-566 aa of BC014094

Sequence: KSLPLGVEELGQLPPVEGPGGRPLRKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPGEKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPSSLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNSTTDSAL

Predict reactive species
Full Name regulator of G-protein signaling 14
Calculated Molecular Weight 566 aa, 61 kDa
Observed Molecular Weight 61 kDa
GenBank Accession NumberBC014094
Gene Symbol RGS14
Gene ID (NCBI) 10636
RRIDAB_2882638
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO43566
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RGS14, a member of the R12 subfamily of RGS proteins, is highly expressed in the brain and is a natural suppressor of CA2 hippocampal synaptic plasticity and learning and memory. RGS14 was first identified as a complex scaffolding protein with an unconventional domain structure that allows it to interact with various protein binding partners. RGS14 contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. The protein attenuates the signaling activity of G-proteins by binding, through its GoLoco domain, to specific types of activated, GTP-bound G alpha subunits. Acting as a GTPase activating protein (GAP), the protein increases the rate of conversion of the GTP to GDP.

Protocols

Product Specific Protocols
FC protocol for RGS14 antibody 67394-1-IgDownload protocol
IF protocol for RGS14 antibody 67394-1-IgDownload protocol
IHC protocol for RGS14 antibody 67394-1-IgDownload protocol
WB protocol for RGS14 antibody 67394-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...