Tested Applications
Positive WB detected in | human placenta tissue |
Positive IHC detected in | human placenta tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human placenta tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
67714-1-Ig targets RHAG in WB, IHC, IF-P, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30130 Product name: Recombinant human RHAG protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-53 aa of BC012605 Sequence: MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPL Predict reactive species |
Full Name | Rh-associated glycoprotein |
Calculated Molecular Weight | 409 aa, 44 kDa |
Observed Molecular Weight | 50-60 kDa |
GenBank Accession Number | BC012605 |
Gene Symbol | RHAG |
Gene ID (NCBI) | 6005 |
RRID | AB_2882904 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q02094 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RHAG antibody 67714-1-Ig | Download protocol |
IHC protocol for RHAG antibody 67714-1-Ig | Download protocol |
IF protocol for RHAG antibody 67714-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |