Tested Applications
| Positive WB detected in | human placenta tissue |
| Positive IHC detected in | human placenta tissue, human stomach cancer tissue, human spleen tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67714-1-Ig targets RHAG in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30130 Product name: Recombinant human RHAG protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-53 aa of BC012605 Sequence: MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPL Predict reactive species |
| Full Name | Rh-associated glycoprotein |
| Calculated Molecular Weight | 409 aa, 44 kDa |
| Observed Molecular Weight | 50-60 kDa |
| GenBank Accession Number | BC012605 |
| Gene Symbol | RHAG |
| Gene ID (NCBI) | 6005 |
| RRID | AB_2882904 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q02094 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RHAG antibody 67714-1-Ig | Download protocol |
| IHC protocol for RHAG antibody 67714-1-Ig | Download protocol |
| WB protocol for RHAG antibody 67714-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RHAG Monoclonal antibody (1C1C4), catalog number 67714-1-Ig, has 1 total citation. The citation appears in FASEB Journal (Impact Factor 4.3), published in 2026. The research field is steroid-induced osteonecrosis of the femoral head, specifically involving identification and screening of lactate-related genes as molecular markers for early diagnosis. The application used was Western Blot in human samples.
| Species | Application | Title |
|---|---|---|
FASEB J Identification and Screening of Lactate-Related Genes as Molecular Markers for Early Diagnosis of Steroid-Induced Osteonecrosis of the Femoral Head. |



















