Product Information
67714-1-PBS targets RHAG in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30130 Product name: Recombinant human RHAG protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-53 aa of BC012605 Sequence: MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPL Predict reactive species |
Full Name | Rh-associated glycoprotein |
Calculated Molecular Weight | 409 aa, 44 kDa |
Observed Molecular Weight | 50-60 kDa |
GenBank Accession Number | BC012605 |
Gene Symbol | RHAG |
Gene ID (NCBI) | 6005 |
RRID | AB_2882904 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q02094 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |