RHAG Monoclonal antibody, PBS Only

• 

  WB analysis of human placenta using 67714-1-Ig (same clone as 67714-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67714-1-Ig (RHAG antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67714-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 67714-1-Ig (same clone as 67714-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67714-1-Ig (RHAG antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer(pH9). This data was developed using the same antibody clone with 67714-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 67714-1-Ig (same clone as 67714-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67714-1-Ig (RHAG antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer(pH9). This data was developed using the same antibody clone with 67714-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 67714-1-Ig (same clone as 67714-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 67714-1-Ig (RHAG antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67714-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 67714-1-Ig (same clone as 67714-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 67714-1-Ig (RHAG antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67714-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human placenta using 67714-1-Ig (same clone as 67714-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human placenta tissue using RHAG antibody (67714-1-Ig, Clone: 1C1C4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67714-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human placenta using 67714-1-Ig (same clone as 67714-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human placenta tissue using RHAG antibody (67714-1-Ig, Clone: 1C1C4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67714-1-PBS in a different storage buffer formulation.

RHAG Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67714-1-PBS

Clone No.1C1C4

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

Ammonium transporter Rh type A, CD241, Rh associated glycoprotein, Rh family type A glycoprotein, Rh type A glycoprotein, RH2, Rh50, RH50A, Rh50GP, RHAG, SLC42A1

---

Product Information

67714-1-PBS targets RHAG in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30130

  Product name: Recombinant human RHAG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-53 aa of BC012605

  Sequence: MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPL

• Full Name: Rh-associated glycoprotein
• Calculated Molecular Weight: 409 aa, 44 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC012605
• Gene Symbol: RHAG
• Gene ID (NCBI): 6005
• RRID: AB_2882904
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q02094
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.