Tested Applications
Positive WB detected in | Jurkat cells, HeLa cells, MCF-7 cells, K-562 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21576-1-AP targets RHOG in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16118 Product name: Recombinant human RHOG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 74-191 aa of BC104178 Sequence: QTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL Predict reactive species |
Full Name | ras homolog gene family, member G (rho G) |
Calculated Molecular Weight | 191 aa, 21 kDa |
Observed Molecular Weight | 21 kDa |
GenBank Accession Number | BC104178 |
Gene Symbol | RHOG |
Gene ID (NCBI) | 391 |
RRID | AB_2878887 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P84095 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RHOG, also named as ARHG, belongs to the small GTPase superfamily and Rho family. It is required for the formation of membrane ruffles during macropinocytosis. And it is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, it is activated by SopB and SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry. This antibody is specific to RHOG.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RHOG antibody 21576-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |