Tested Applications
Positive WB detected in | THP-1 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
29080-1-AP targets RIPK3 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30337 Product name: Recombinant human RIPK3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 132-202 aa of BC062584 Sequence: HDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTAS Predict reactive species |
Full Name | receptor-interacting serine-threonine kinase 3 |
Calculated Molecular Weight | 518 aa, 57 kDa |
Observed Molecular Weight | 57 kDa |
GenBank Accession Number | BC062584 |
Gene Symbol | RIPK3 |
Gene ID (NCBI) | 11035 |
RRID | AB_3086097 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y572 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RIPK3,also named as RIP3, a Ser/Thr kinase of RIP (Receptor Interacting Protein) family, is recruited to the TNFR1 signaling complex through RIP and has been shown to mediate apoptosis induction and NF-κB activation. RIPK3 is a nucleocytoplasmic shuttling protein and its unconventional nuclear localization signal (NLS, 442-472 aa) is sufficient to trigger apoptosis in the nucleus(PMID:18533105). It has 3 isoforms produced by alternative splicing. RIPK3 might form a homodimer within cells, and its apoptotic activity may not be required for this dimerization(PMID:18533105).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RIPK3 antibody 29080-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |