Tested Applications
| Positive WB detected in | HepG2 cells, THP-1 cells, L02 cells, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29080-1-AP targets RIPK3 in WB, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30337 Product name: Recombinant human RIPK3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 132-202 aa of BC062584 Sequence: HDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTAS Predict reactive species |
| Full Name | receptor-interacting serine-threonine kinase 3 |
| Calculated Molecular Weight | 518 aa, 57 kDa |
| Observed Molecular Weight | 57 kDa |
| GenBank Accession Number | BC062584 |
| Gene Symbol | RIPK3 |
| Gene ID (NCBI) | 11035 |
| RRID | AB_3086097 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y572 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RIPK3,also named as RIP3, a Ser/Thr kinase of RIP (Receptor Interacting Protein) family, is recruited to the TNFR1 signaling complex through RIP and has been shown to mediate apoptosis induction and NF-κB activation. RIPK3 is a nucleocytoplasmic shuttling protein and its unconventional nuclear localization signal (NLS, 442-472 aa) is sufficient to trigger apoptosis in the nucleus(PMID:18533105). It has 3 isoforms produced by alternative splicing. RIPK3 might form a homodimer within cells, and its apoptotic activity may not be required for this dimerization(PMID:18533105).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for RIPK3 antibody 29080-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RIPK3 Polyclonal antibody (Cat# 29080-1-AP) has 17 citations across journals including Nature Cell Biology, Biomaterials, PNAS, Frontiers in Immunology, mBio, FASEB Journal, and others. Research fields span necroptosis, PANoptosis, ferroptosis, apoptosis, cancer immunotherapy, vascular inflammation, acute lung injury, psoriasis, liver injury, sepsis, kidney injury, thyroid cancer, neuroinflammation, and intestinal barrier biology.
| Species | Application | Title |
|---|---|---|
Biomaterials A novel nano-biocomposite synergistically activates PANoptosis and cGAS-STING for precise cancer immunotherapy. | ||
Biomaterials Radiation-triggerable bioreactors enable bioenergetic reprograming of cancer stem cell plasticity via targeted arginine metabolism disruption for augmented radio-immunotherapy | ||
Proc Natl Acad Sci U S A PARP12-mediated mono-ADP-ribosylation as a checkpoint for necroptosis and apoptosis. | ||
Biomed Pharmacother Cilostazol attenuates vascular inflammation via the regulation of TICAM1/IRF3 signaling pathway | ||
Front Immunol Farrerol inhibits ferroptosis and protects against LPS-induced acute lung injury by targeting the RUNX1/SLC7A11 axis. |
