Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, human placenta tissue |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26977-1-AP targets RIT1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25636 Product name: Recombinant human RIT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 140-219 aa of BC104186 Sequence: QLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT Predict reactive species |
| Full Name | Ras-like without CAAX 1 |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 25-28 kDa |
| GenBank Accession Number | BC104186 |
| Gene Symbol | RIT1 |
| Gene ID (NCBI) | 6016 |
| RRID | AB_3669578 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92963 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RIT1 (Ras-like without CAAX protein 1) is also named as RIBB, ROC1 and GTP-binding protein Rit1. RIT1 serves as a regulatory factor for neuronal cell proliferation, survival, and differentiation (PMID: 28007959). Rit1 mediates oxidative stress resistance, contributing to cell survival via the p38 MAPK signaling pathway (PMID: 21737674). As a small G protein of Ras family, RIT1 plays a critical role in various tumors (such as hepatocellular carcinoma, HCC) (PMID: 38017479). It is worth noting that RIT1 is frequently amplified in various human cancers including HCC, lung adenocarcinoma, cholangiocarcinoma, uterine carcinosarcoma, breast cancer, and ovarian cancer (PMID: 38017479).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for RIT1 antibody 26977-1-AP | Download protocol |
| IF protocol for RIT1 antibody 26977-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



