Tested Applications
Positive WB detected in | mouse brain tissue, human brain tissue, Jurkat cells, L02 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21394-1-AP targets RLBP1L2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16061 Product name: Recombinant human RLBP1L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 265-327 aa of BC101376 Sequence: LLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD Predict reactive species |
Full Name | retinaldehyde binding protein 1-like 2 |
Calculated Molecular Weight | 327 aa, 38 kDa |
Observed Molecular Weight | 38 kDa |
GenBank Accession Number | BC101376 |
Gene Symbol | RLBP1L2 |
Gene ID (NCBI) | 134829 |
RRID | AB_10732818 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q5SYC1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RLBP1L2 antibody 21394-1-AP | Download protocol |
IF protocol for RLBP1L2 antibody 21394-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |