Tested Applications
| Positive WB detected in | human brain tissue, Jurkat cells, L02 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21394-1-AP targets RLBP1L2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16061 Product name: Recombinant human RLBP1L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 265-327 aa of BC101376 Sequence: LLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD Predict reactive species |
| Full Name | retinaldehyde binding protein 1-like 2 |
| Calculated Molecular Weight | 327 aa, 38 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC101376 |
| Gene Symbol | RLBP1L2 |
| Gene ID (NCBI) | 134829 |
| RRID | AB_10732818 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5SYC1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RLBP1L2 antibody 21394-1-AP | Download protocol |
| WB protocol for RLBP1L2 antibody 21394-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







