RLBP1L2 Polyclonal antibody

• 

  WB analysis of human brain using 21394-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 21394-1-AP (RLBP1L2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 21394-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 21394-1-AP (RLBP1L2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 21394-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 21394-1-AP (RLBP1L2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 21394-1-AP

  Immunofluorescent analysis of Hela cells, using RLBP1L2 antibody 21394-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

RLBP1L2 Polyclonal Antibody for WB, ELISA

Cat No. 21394-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

C6orf212, C6orf213, Clavesin 2, Clavesin-2, CLVS2, RLBP1L2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human brain tissue, Jurkat cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21394-1-AP targets RLBP1L2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16061

  Product name: Recombinant human RLBP1L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 265-327 aa of BC101376

  Sequence: LLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD

• Full Name: retinaldehyde binding protein 1-like 2
• Calculated Molecular Weight: 327 aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC101376
• Gene Symbol: RLBP1L2
• Gene ID (NCBI): 134829
• RRID: AB_10732818
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5SYC1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.