Use Able AI chat for product recommendations

RNASE2/EDN Polyclonal antibody, PBS Only

RNASE2/EDN Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 18172-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

RNASE2, EC:4.6.1.18, EDN, Eosinophil-derived neurotoxin, Non-secretory ribonuclease

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

18172-1-PBS targets RNASE2/EDN in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12834

Product name: Recombinant human RNASE2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 31-161 aa of BC093678

Sequence: QFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII

Predict reactive species
Full Name ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Calculated Molecular Weight 161 aa, 18 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC093678
Gene Symbol RNASE2
Gene ID (NCBI) 6036
RRIDAB_3669293
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10153
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RNASE2, also known as eosinophil-derived neurotoxin (EDN), is a member of the RNase A superfamily and is predominantly expressed in eosinophilic leukocytes, where it is stored in large quantities within specific cytoplasmic granules. Structurally, RNASE2 possesses a catalytic domain that confers ribonuclease activity, which enables its primary role in the host immune response against viral infections by directly degrading viral RNA, thereby inhibiting viral replication. Upon release from activated eosinophils, RNASE2 can signal through pattern recognition receptors such as Toll-like receptor 2 (TLR2) to activate dendritic cells and promote T-helper type 2 (Th2) immune responses. Elevated levels of RNASE2 are found in various inflammatory conditions, including asthma, allergic rhinitis, and parasitic infections, making it a key biomarker for eosinophil activation. Beyond its roles in immunity and inflammation, RNASE2 also exhibits neurotoxic activity, and has been implicated in wound healing and tissue remodeling processes.

Loading...
||
New chat

Able

正在加载,请稍候...