RNASE2/EDN Polyclonal antibody, PBS Only

• 

  WB analysis using 18172-1-AP (same clone as 18172-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18172-1-AP (RNASE2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18172-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 18172-1-AP (same clone as 18172-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 18172-1-AP (RNASE2 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18172-1-PBS in a different storage buffer formulation.

RNASE2/EDN Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 18172-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

RNASE2, RNase UpI-2, RNase 2, Non-secretory ribonuclease, Eosinophil-derived neurotoxin

---

Product Information

18172-1-PBS targets RNASE2/EDN in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12834

  Product name: Recombinant human RNASE2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-161 aa of BC093678

  Sequence: QFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII

• Full Name: ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
• Calculated Molecular Weight: 161 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC093678
• Gene Symbol: RNASE2
• Gene ID (NCBI): 6036
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10153
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.