RP2 Monoclonal antibody

• 

  WB analysis of HepG2 using 67795-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67795-1-Ig (RP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67795-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67795-1-Ig (RP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67795-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67795-1-Ig (RP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Y79 using 67795-1-Ig

  Y79 cells were subjected to SDS PAGE followed by western blot with 67795-1-Ig (RP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

RP2 Monoclonal Antibody for WB, ELISA

Cat No. 67795-1-Ig

Clone No.1G2A9

Host / Isotype

Mouse / IgG1

Reactivity

Human, rabbit

Applications

WB, ELISA

Synonyms

DELXp11.3, KIAA0215, Protein XRP2, RP2, TBCCD2

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, Y79 cells, Jurkat cells, human platelets tissue, human placenta tissue, rabbit retina tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67795-1-Ig targets RP2 in WB, ELISA applications and shows reactivity with Human, rabbit samples.

• Tested Reactivity: Human, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5630

  Product name: Recombinant human RP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC043348

  Sequence: MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI

• Full Name: retinitis pigmentosa 2 (X-linked recessive)
• Calculated Molecular Weight: 350 aa, 40 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC043348
• Gene Symbol: RP2
• Gene ID (NCBI): 6102
• RRID: AB_2918559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75695
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.