Use Able AI chat for product recommendations
  • KD/KO Validated

RP2 Monoclonal antibody

RP2 Monoclonal Antibody for WB, ELISA

Cat No. 67795-1-Ig
Clone No.1G2A9

Host / Isotype

Mouse / IgG1

Reactivity

human, rabbit

Applications

WB, ELISA

1G2A9, DELXp11.3, KIAA0215, Protein XRP2, TBCCD2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HeLa cells, Y79 cells, Jurkat cells, human platelets tissue, human placenta tissue, rabbit retina tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67795-1-Ig targets RP2 in WB, ELISA applications and shows reactivity with human, rabbit samples.

Tested Reactivity human, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5630

Product name: Recombinant human RP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-350 aa of BC043348

Sequence: MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI

Predict reactive species
Full Name retinitis pigmentosa 2 (X-linked recessive)
Calculated Molecular Weight 350 aa, 40 kDa
Observed Molecular Weight37-40 kDa
GenBank Accession NumberBC043348
Gene Symbol RP2
Gene ID (NCBI) 6102
RRIDAB_2918559
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO75695
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein XRP2, more popularly known as RP2 (Retinitis Pigmentosa 2), is a protein that is essential for maintaining the structure of eye cells, and its defects are directly related to serious hereditary retinal degenerative diseases. RP2 is a cofactor that assists the assembly of tubulin complex, and plays a key role in the formation and function of intracellular microtubule network. It mainly plays a positioning and regulating role in cilia production and intracellular transport. Mutation of the gene encoding this protein will lead to X-linked retinitis pigmentosa (XLRP). This is a hereditary retinal degenerative disease, characterized by progressive vision loss, which usually begins with night blindness, then peripheral vision loss, and may eventually lead to blindness. The loss of RP2 protein function leads to the failure of photoreceptor cells (cone and rod cells) to maintain their normal microtubule structure, which leads to apoptosis.

Protocols

Product Specific Protocols
WB protocol for RP2 antibody 67795-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...