Use Able AI chat for product recommendations

RP2 Monoclonal antibody, PBS Only

RP2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67795-1-PBS
Clone No.1G2A9

Host / Isotype

Mouse / IgG1

Reactivity

human, rabbit

Applications

WB, Indirect ELISA

1G2A9, DELXp11.3, KIAA0215, Protein XRP2, TBCCD2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67795-1-PBS targets RP2 in WB, Indirect ELISA applications and shows reactivity with human, rabbit samples.

Tested Reactivity human, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5630

Product name: Recombinant human RP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-350 aa of BC043348

Sequence: MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI

Predict reactive species
Full Name retinitis pigmentosa 2 (X-linked recessive)
Calculated Molecular Weight 350 aa, 40 kDa
Observed Molecular Weight37-40 kDa
GenBank Accession NumberBC043348
Gene Symbol RP2
Gene ID (NCBI) 6102
RRIDAB_2918559
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO75695
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Protein XRP2, more popularly known as RP2 (Retinitis Pigmentosa 2), is a protein that is essential for maintaining the structure of eye cells, and its defects are directly related to serious hereditary retinal degenerative diseases. RP2 is a cofactor that assists the assembly of tubulin complex, and plays a key role in the formation and function of intracellular microtubule network. It mainly plays a positioning and regulating role in cilia production and intracellular transport. Mutation of the gene encoding this protein will lead to X-linked retinitis pigmentosa (XLRP). This is a hereditary retinal degenerative disease, characterized by progressive vision loss, which usually begins with night blindness, then peripheral vision loss, and may eventually lead to blindness. The loss of RP2 protein function leads to the failure of photoreceptor cells (cone and rod cells) to maintain their normal microtubule structure, which leads to apoptosis.

Loading...
||
New chat

Able

正在加载,请稍候...