RP2 Monoclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 67795-1-Ig (same clone as 67795-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67795-1-Ig (RP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67795-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67795-1-Ig (same clone as 67795-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67795-1-Ig (RP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67795-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67795-1-Ig (same clone as 67795-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67795-1-Ig (RP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67795-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Y79 using 67795-1-Ig (same clone as 67795-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 67795-1-Ig (RP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67795-1-PBS in a different storage buffer formulation.

RP2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67795-1-PBS

Clone No.1G2A9

Host / Isotype

Mouse / IgG1

Reactivity

Human, rabbit

Applications

WB, Indirect ELISA

Synonyms

DELXp11.3, KIAA0215, Protein XRP2, RP2, TBCCD2

---

Product Information

67795-1-PBS targets RP2 in WB, Indirect ELISA applications and shows reactivity with Human, rabbit samples.

• Tested Reactivity: Human, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5630

  Product name: Recombinant human RP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC043348

  Sequence: MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI

• Full Name: retinitis pigmentosa 2 (X-linked recessive)
• Calculated Molecular Weight: 350 aa, 40 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC043348
• Gene Symbol: RP2
• Gene ID (NCBI): 6102
• RRID: AB_2918559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75695
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.