RP2 Monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RP2 Monoclonal antibody, PBS Only (67795-1-PBS)

• 

  WB analysis of HepG2 using 67795-1-Ig (same clone as 67795-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67795-1-Ig (RP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67795-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67795-1-Ig (same clone as 67795-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67795-1-Ig (RP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67795-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67795-1-Ig (same clone as 67795-1-PBS)

  WB result of RP2 antibody (67795-1-Ig; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-RP2 transfected HepG2 cells. This data was developed using the same antibody clone with 67795-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Y79 using 67795-1-Ig (same clone as 67795-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 67795-1-Ig (RP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67795-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67795-1-Ig (same clone as 67795-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67795-1-Ig (RP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67795-1-PBS in a different storage buffer formulation.

RP2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67795-1-PBS

Clone No.1G2A9

Host / Isotype

Mouse / IgG1

Reactivity

human, rabbit

Applications

WB, Indirect ELISA

Synonyms

1G2A9, DELXp11.3, KIAA0215, Protein XRP2, TBCCD2

---

Product Information

67795-1-PBS targets RP2 in WB, Indirect ELISA applications and shows reactivity with human, rabbit samples.

• Tested Reactivity: human, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5630

  Product name: Recombinant human RP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC043348

  Sequence: MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI

• Full Name: retinitis pigmentosa 2 (X-linked recessive)
• Calculated Molecular Weight: 350 aa, 40 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC043348
• Gene Symbol: RP2
• Gene ID (NCBI): 6102
• RRID: AB_2918559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75695
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Protein XRP2, more popularly known as RP2 (Retinitis Pigmentosa 2), is a protein that is essential for maintaining the structure of eye cells, and its defects are directly related to serious hereditary retinal degenerative diseases. RP2 is a cofactor that assists the assembly of tubulin complex, and plays a key role in the formation and function of intracellular microtubule network. It mainly plays a positioning and regulating role in cilia production and intracellular transport. Mutation of the gene encoding this protein will lead to X-linked retinitis pigmentosa (XLRP). This is a hereditary retinal degenerative disease, characterized by progressive vision loss, which usually begins with night blindness, then peripheral vision loss, and may eventually lead to blindness. The loss of RP2 protein function leads to the failure of photoreceptor cells (cone and rod cells) to maintain their normal microtubule structure, which leads to apoptosis.