RPGRIP1L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RPGRIP1L Polyclonal antibody, PBS Only (29778-1-PBS)

• 

  WB analysis using 29778-1-AP (same clone as 29778-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29778-1-AP (RPGRIP1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29778-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29778-1-AP (same clone as 29778-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29778-1-AP (RPGRIP1L antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29778-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 29778-1-AP (same clone as 29778-1-PBS)

  Mouse testis tissue were subjected to SDS PAGE followed by western blot with 29778-1-AP (RPGRIP1L antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29778-1-PBS in a different storage buffer formulation.

RPGRIP1L Polyclonal Antibody for WB, Indirect ELISA

Cat No. 29778-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

29778-1-PBS targets RPGRIP1L in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31168

  Product name: Recombinant human RPGRIP1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-140 aa of NM_015272

  Sequence: MSGPTDETAGDLPVKDTGLNLFGMGGLQETSTTRTMKSRQAVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVHELEKQNETLKNRLISAKQQL

• Full Name: RPGRIP1-like
• Calculated Molecular Weight: 151 kDa
• Observed Molecular Weight: 151 kDa
• GenBank Accession Number: NM_015272
• Gene Symbol: RPGRIP1L
• Gene ID (NCBI): 23322
• RRID: AB_2923607
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q68CZ1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RPGRIP1L, also named as FTM, KIAA1005, belongs to the RPGRIP1 family. It negatively regulates signaling through the G-protein coupled thromboxane A2 receptor. RPGRIP1L may be involved in mechanisms like programmed cell death, craniofacial development, patterning of the limbs, and formation of the left-right axis.(PMID:17558409) Defects in RPGRIP1L are the cause of Joubert syndrome type 7 (JBTS7). Defects in RPGRIP1L are the cause of Meckel syndrome type 5 (MKS5).