RPGRIP1L Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RPGRIP1L Polyclonal antibody (29778-1-AP)

RPGRIP1L Polyclonal Antibody for WB, ELISA

Cat No. 29778-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat and More (2)

Applications

WB, IF, ELISA

Synonyms

CORS3, DKFZp686C0668, FTM, JBTS7, KIAA1005, MKS5, Protein fantom, RPGRIP1 like, RPGRIP1 like protein, RPGRIP1L

• 

  WB analysis using 29778-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29778-1-AP (RPGRIP1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 29778-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29778-1-AP (RPGRIP1L antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 29778-1-AP

  Mouse testis tissue were subjected to SDS PAGE followed by western blot with 29778-1-AP (RPGRIP1L antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RPGRIP1L in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse testis tissue, HEK-293 cells, Jurkat cells, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29778-1-AP targets RPGRIP1L in WB, IF, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: human, mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31168

  Product name: Recombinant human RPGRIP1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-140 aa of NM_015272

  Sequence: MSGPTDETAGDLPVKDTGLNLFGMGGLQETSTTRTMKSRQAVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVHELEKQNETLKNRLISAKQQL

• Full Name: RPGRIP1-like
• Calculated Molecular Weight: 151 kDa
• Observed Molecular Weight: 151 kDa
• GenBank Accession Number: NM_015272
• Gene Symbol: RPGRIP1L
• Gene ID (NCBI): 23322
• RRID: AB_2923607
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q68CZ1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RPGRIP1L, also named as FTM, KIAA1005, belongs to the RPGRIP1 family. It negatively regulates signaling through the G-protein coupled thromboxane A2 receptor. RPGRIP1L may be involved in mechanisms like programmed cell death, craniofacial development, patterning of the limbs, and formation of the left-right axis.(PMID:17558409) Defects in RPGRIP1L are the cause of Joubert syndrome type 7 (JBTS7). Defects in RPGRIP1L are the cause of Meckel syndrome type 5 (MKS5).

Publications

What published studies show

The RPGRIP1L Polyclonal antibody (Cat# 29778-1-AP) has 5 total citations published in Cell Mol Neurobiol, Dis Model Mech, bioRxiv, eLife, and Nat Commun. The associated research fields span neurobiology (behavioral phenotypes in SUMO1 knockout mice), ciliogenesis and ciliary transition zone biology, Meckel-Gruber syndrome/Wnt signaling, centriolar satellite function, and phase-separated condensate assembly in cilia.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Mol Neurobiol; Downregulation of Hmox1 and Rpgrip1l Expression Linked to Risk-Taking Behavior, Reduced Depressive Symptoms, and Diminished Novelty Socialization in SUMO1 Knockout Mice; Authors - Qiwei Dai
human,zebrafish	WB	Dis Model Mech; Variable phenotypes and penetrance between and within different zebrafish ciliary transition zone mutants; Authors - Jun Wang
human	IF	Elife; Centriolar satellites expedite mother centriole remodeling to promote ciliogenesis; Authors - Emma A Hall
	IF	bioRxiv; Two functional forms of the Meckel-Gruber syndrome protein TMEM67 generated by proteolytic cleavage by ADAMTS9 mediate Wnt signaling and ciliogenesis; Authors - Manu Ahmed
human	IF	Nat Commun; CFAP100 forms phase-separated condensates required for ciliary transition zone assembly.; Authors - Shuang Sun