RPL12 Monoclonal antibody, PBS Only

• 

  WB analysis using 68110-1-Ig (same clone as 68110-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68110-1-Ig (RPL12 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68110-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 68110-1-Ig (same clone as 68110-1-PBS)

  WB result of RPL12 antibody (68110-1-Ig; 1:100000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RPL12 transfected HeLa cells. This data was developed using the same antibody clone with 68110-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 68110-1-Ig (same clone as 68110-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 68110-1-Ig (RPL12 antibody) at dilution of 1:16000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68110-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68110-1-Ig (same clone as 68110-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68110-1-Ig (RPL12 antibody) at dilution of 1:16000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68110-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 68110-1-Ig (same clone as 68110-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 68110-1-Ig (RPL12 antibody) at dilution of 1:16000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68110-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 68110-1-Ig (same clone as 68110-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 68110-1-Ig (RPL12 antibody) at dilution of 1:16000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68110-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat stomach using 68110-1-Ig (same clone as 68110-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 68110-1-Ig (RPL12 antibody) at dilution of 1:16000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68110-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 68110-1-Ig (same clone as 68110-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 68110-1-Ig (RPL12 antibody) at dilution of 1:32000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68110-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RPL12 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 68110-1-PBS

Clone No.2C9B3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

2C9B3, 60S ribosomal protein L12, Large ribosomal subunit protein uL11, ribosomal protein L12

---

Product Information

68110-1-PBS targets RPL12 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6580

  Product name: Recombinant human RPL12 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-165 aa of BC050644

  Sequence: MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS

• Full Name: ribosomal protein L12
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC050644
• Gene Symbol: RPL12
• Gene ID (NCBI): 6136
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P30050
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.