Tested Applications
Positive WB detected in | A549 cells, PC-3 cells, HT-29 cells |
Positive IP detected in | HT-29 cells |
Positive IHC detected in | human renal cell carcinoma tissue, mouse kidney tissue, mouse colon tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 4 publications below |
IHC | See 1 publications below |
Product Information
27457-1-AP targets RRAS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26538 Product name: Recombinant human RRAS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 145-218 aa of BC016318 Sequence: DLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL Predict reactive species |
Full Name | related RAS viral (r-ras) oncogene homolog |
Calculated Molecular Weight | 218 aa, 23 kDa |
Observed Molecular Weight | 23 kDa |
GenBank Accession Number | BC016318 |
Gene Symbol | RRAS |
Gene ID (NCBI) | 6237 |
RRID | AB_2880876 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P10301 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RRAS antibody 27457-1-AP | Download protocol |
IHC protocol for RRAS antibody 27457-1-AP | Download protocol |
IP protocol for RRAS antibody 27457-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun Targeting NRAS via miR-1304-5p or farnesyltransferase inhibition confers sensitivity to ALK inhibitors in ALK-mutant neuroblastoma | ||
Biomaterials Polymeric nanoparticle mediated inhibition of miR-21 with enhanced miR-124 expression for combinatorial glioblastoma therapy. | ||
Transl Cancer Res Identification of RRAS gene related to nasopharyngeal carcinoma based on pathway and network-based analyses. | ||
Hepatology Metabolism-induced tumor activator 1 (MITA1), an Energy Stress-Inducible Long Noncoding RNA, Promotes Hepatocellular Carcinoma Metastasis | ||
Cancer Lett Integrated multi-omics analyses of oral squamous cell carcinoma reveal precision patient stratification and personalized treatment strategies |