RRAS Polyclonal antibody

• 

  WB analysis using 27457-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27457-1-AP (RRAS antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 27457-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 27457-1-AP (RRAS antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 27457-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 27457-1-AP (RRAS antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HT-29 using 27457-1-AP

  IP result of anti-RRAS (IP:27457-1-AP, 4ug; Detection:27457-1-AP 1:500) with HT-29 cells lysate 3320 ug.

• 

  IHC staining of human renal cell carcinoma using 27457-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 27457-1-AP (RRAS antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human renal cell carcinoma using 27457-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 27457-1-AP (RRAS antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 27457-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27457-1-AP (RRAS antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 27457-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 27457-1-AP (RRAS antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 27457-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 27457-1-AP (RRAS antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 27457-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 27457-1-AP (RRAS antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 27457-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 27457-1-AP (RRAS antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 27457-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27457-1-AP (RRAS antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RRAS Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 27457-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

Synonyms

p23, Ras related protein R Ras, RRAS

---

Tested Applications

• Positive WB detected in: A549 cells, PC-3 cells, HT-29 cells
• Positive IP detected in: HT-29 cells
• Positive IHC detected in: human renal cell carcinoma tissue, mouse kidney tissue, mouse colon tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 1 publications below

Product Information

27457-1-AP targets RRAS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26538

  Product name: Recombinant human RRAS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 145-218 aa of BC016318

  Sequence: DLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL

• Full Name: related RAS viral (r-ras) oncogene homolog
• Calculated Molecular Weight: 218 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC016318
• Gene Symbol: RRAS
• Gene ID (NCBI): 6237
• RRID: AB_2880876
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10301
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Targeting NRAS via miR-1304-5p or farnesyltransferase inhibition confers sensitivity to ALK inhibitors in ALK-mutant neuroblastoma; Authors - Perla Pucci
human，mouse	WB	Biomaterials; Polymeric nanoparticle mediated inhibition of miR-21 with enhanced miR-124 expression for combinatorial glioblastoma therapy.; Authors - Yuanyuan Liu
human	WB	Transl Cancer Res; Identification of RRAS gene related to nasopharyngeal carcinoma based on pathway and network-based analyses.; Authors - Ruowen Xiao
human	WB	Hepatology; Metabolism-induced tumor activator 1 (MITA1), an Energy Stress-Inducible Long Noncoding RNA, Promotes Hepatocellular Carcinoma Metastasis; Authors - Meilin Ma
	IHC	Cancer Lett; Integrated multi-omics analyses of oral squamous cell carcinoma reveal precision patient stratification and personalized treatment strategies; Authors - Chi-Sheng Wu