RRAS Monoclonal antibody

• Home
• Products
• Primary Antibodies
• RRAS Monoclonal antibody (66959-1-Ig)

RRAS Monoclonal Antibody for WB, ELISA

Cat No. 66959-1-Ig Copied!

Clone No. 2E1A12

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, Rat and More (1)

Applications

WB, ELISA

Synonyms

p23, Ras related protein R Ras, RRAS

• 

  WB analysis of A549 using 66959-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 66959-1-Ig

  PC-3 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HT-29 using 66959-1-Ig

  HT-29 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HSC-T6 using 66959-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 66959-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RRAS in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, PC-3 cells, HT-29 cells, HSC-T6 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:4000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66959-1-Ig targets RRAS in WB, ELISA applications and shows reactivity with Human, mouse, Rat samples.

• Tested Reactivity: Human, mouse, Rat
• Cited Reactivity: rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26564

  Product name: Recombinant human RRAS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 145-218 aa of BC016318

  Sequence: DLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL

• Full Name: related RAS viral (r-ras) oncogene homolog
• Calculated Molecular Weight: 218 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC016318
• Gene Symbol: RRAS
• Gene ID (NCBI): 6237
• RRID: AB_2882282
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10301
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RRAS belongs to the Ras subfamily of small G-proteins, which are frequently implicated in cell growth and differentiation.RRAS is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers.

Publications

What published studies show

The RRAS Monoclonal antibody (2E1A12), catalog number 66959-1-Ig, has a total of 1 citation. The citation appears in Frontiers in Physiology (2025), in a study investigating mitophagy-associated biomarkers and macrophage involvement in pulmonary arterial hypertension. The research field encompasses mitophagy, vascular biology, and inflammatory cell biology. The antibody was used for Western blot analysis in rat samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Front Physiol; Mitophagy-associated biomarkers and macrophage involvement in pulmonary arterial hypertension: identification and functional implications.; Authors - Xiaoyu Zhang