Tested Applications
Positive WB detected in | A549 cells, PC-3 cells, HT-29 cells, HSC-T6 cells, NIH/3T3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:4000-1:8000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
66959-1-Ig targets RRAS in WB, ELISA applications and shows reactivity with Human, mouse, Rat samples.
Tested Reactivity | Human, mouse, Rat |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26564 Product name: Recombinant human RRAS protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 145-218 aa of BC016318 Sequence: DLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL Predict reactive species |
Full Name | related RAS viral (r-ras) oncogene homolog |
Calculated Molecular Weight | 218 aa, 23 kDa |
Observed Molecular Weight | 23 kDa |
GenBank Accession Number | BC016318 |
Gene Symbol | RRAS |
Gene ID (NCBI) | 6237 |
RRID | AB_2882282 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P10301 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RRAS belongs to the Ras subfamily of small G-proteins, which are frequently implicated in cell growth and differentiation.RRAS is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RRAS antibody 66959-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |