RRAS Monoclonal antibody

• 

  WB analysis of A549 using 66959-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 66959-1-Ig

  PC-3 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-29 using 66959-1-Ig

  HT-29 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 66959-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 66959-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

RRAS Monoclonal Antibody for WB, ELISA

Cat No. 66959-1-Ig

Clone No.2E1A12

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, Rat

Applications

WB, ELISA

Synonyms

p23, Ras related protein R Ras, RRAS

---

Tested Applications

• Positive WB detected in: A549 cells, PC-3 cells, HT-29 cells, HSC-T6 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:4000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66959-1-Ig targets RRAS in WB, ELISA applications and shows reactivity with Human, mouse, Rat samples.

• Tested Reactivity: Human, mouse, Rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26564

  Product name: Recombinant human RRAS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 145-218 aa of BC016318

  Sequence: DLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL

• Full Name: related RAS viral (r-ras) oncogene homolog
• Calculated Molecular Weight: 218 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC016318
• Gene Symbol: RRAS
• Gene ID (NCBI): 6237
• RRID: AB_2882282
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10301
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RRAS belongs to the Ras subfamily of small G-proteins, which are frequently implicated in cell growth and differentiation.RRAS is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers.