RRAS Monoclonal antibody, PBS Only

• 

  WB analysis of A549 using 66959-1-Ig (same clone as 66959-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66959-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 66959-1-Ig (same clone as 66959-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66959-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-29 using 66959-1-Ig (same clone as 66959-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66959-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 66959-1-Ig (same clone as 66959-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66959-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66959-1-Ig (same clone as 66959-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66959-1-Ig (RRAS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66959-1-PBS in a different storage buffer formulation.

RRAS Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66959-1-PBS

Clone No.2E1A12

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, Rat

Applications

WB, Indirect ELISA

Synonyms

p23, Ras related protein R Ras, RRAS

---

Product Information

66959-1-PBS targets RRAS in WB, Indirect ELISA applications and shows reactivity with Human, mouse, Rat samples.

• Tested Reactivity: Human, mouse, Rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26564

  Product name: Recombinant human RRAS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 145-218 aa of BC016318

  Sequence: DLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL

• Full Name: related RAS viral (r-ras) oncogene homolog
• Calculated Molecular Weight: 218 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC016318
• Gene Symbol: RRAS
• Gene ID (NCBI): 6237
• RRID: AB_2882282
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10301
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RRAS belongs to the Ras subfamily of small G-proteins, which are frequently implicated in cell growth and differentiation.RRAS is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers.