Product Information
66959-1-PBS targets RRAS in WB, Indirect ELISA applications and shows reactivity with Human, mouse, Rat samples.
Tested Reactivity | Human, mouse, Rat |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26564 Product name: Recombinant human RRAS protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 145-218 aa of BC016318 Sequence: DLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL Predict reactive species |
Full Name | related RAS viral (r-ras) oncogene homolog |
Calculated Molecular Weight | 218 aa, 23 kDa |
Observed Molecular Weight | 23 kDa |
GenBank Accession Number | BC016318 |
Gene Symbol | RRAS |
Gene ID (NCBI) | 6237 |
RRID | AB_2882282 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P10301 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
RRAS belongs to the Ras subfamily of small G-proteins, which are frequently implicated in cell growth and differentiation.RRAS is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers.