Tested Applications
Positive WB detected in | A431 cells, HeLa cells, A549 cells, K-562 cells, BxPC-3 cells, HEK-293 cells, U-251 cells |
Positive IP detected in | K-562 cells |
Positive IHC detected in | human breast cancer tissue, human lung cancer tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells, Raji cells |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:16000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:100-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 18 publications below |
IHC | See 35 publications below |
IF | See 3 publications below |
IP | See 1 publications below |
Product Information
10526-1-AP targets RRM1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.
Tested Reactivity | human, mouse, rat, monkey |
Cited Reactivity | human, mouse, xenopus |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0789 Product name: Recombinant human RRM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 593-792 aa of BC006498 Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS Predict reactive species |
Full Name | ribonucleotide reductase M1 |
Calculated Molecular Weight | 90 kDa |
Observed Molecular Weight | 90 kDa |
GenBank Accession Number | BC006498 |
Gene Symbol | RRM1 |
Gene ID (NCBI) | 6240 |
RRID | AB_2180372 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P23921 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ribonucleoside-diphosphate reductase large subunit (RRM1) is the main enzyme for de novo deoxyribonucleotide
synthesis necessary for DNA synthesis during the cell cycle as well as during DNA repair.
What is the molecular weight of RRM1?
The molecular weight of RRM1 is 90 kDa. RRM1 is a part of ribonucleotide reductase (RNR), which is composed
of two large RRM1 and two small RRM2 subunits in S phase and two large RRM1 and two alternative small p53R2
subunits in non-dividing quiescent cells (PMID: 17416930).
What is the subcellular localization of RRM1?
RRM1 localizes to the cytoplasm, where it is responsible for dNTP production, forming a complex with RRM2.
However, RRM1 can be recruited to DNA damage sites in the nucleus via interaction with Tip60 (PMID: 20159953).
What is the tissue expression pattern of RRM1?
RRM1 is ubiquitously expressed.
How is RRM1 expression regulated during the cell cycle and upon DNA damage?
Rrm1 gene expression levels depend on the cell cycle, and the highest mRNA levels are observed in S phase.
However, RRM1 protein levels are constant throughout the cell cycle due to long protein half-life, contrary to
RRM2, which is actively degraded after cell exit from S phase. During DNA damage, e.g., induced with genotoxins
or UV light, expression of RRM1 and RRM2/p53R2 is upregulated (PMID: 1551913 and 8798592).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RRM1 antibody 10526-1-AP | Download protocol |
IHC protocol for RRM1 antibody 10526-1-AP | Download protocol |
IF protocol for RRM1 antibody 10526-1-AP | Download protocol |
IP protocol for RRM1 antibody 10526-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Lancet Oncol The ribonucleotide reductase large subunit (RRM1) as a predictive factor in patients with cancer. | ||
Cell Death Dis MTCH2 regulates NRF2-mediated RRM1 expression to promote melanoma proliferation and dacarbazine insensitivity | ||