• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated RRM1 Polyclonal antibody

RRM1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-10526

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

IF/ICC, FC (Intra)

EC:1.17.4.1, Ribonucleoside-diphosphate reductase large subunit, Ribonucleoside-diphosphate reductase subunit M1, ribonucleotide reductase M1, RIR1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10526 targets RRM1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, monkey samples.

Tested Reactivity human, mouse, rat, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0789

Product name: Recombinant human RRM1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 593-792 aa of BC006498

Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS

Predict reactive species
Full Name ribonucleotide reductase M1
Calculated Molecular Weight 90 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC006498
Gene Symbol RRM1
Gene ID (NCBI) 6240
RRIDAB_2918984
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen Affinity Purified
UNIPROT IDP23921
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ribonucleoside-diphosphate reductase large subunit (RRM1) is the main enzyme for de novo deoxyribonucleotide 

synthesis necessary for DNA synthesis during the cell cycle as well as during DNA repair.


What is the molecular weight of RRM1?

The molecular weight of RRM1 is 90 kDa. RRM1 is a part of ribonucleotide reductase (RNR), which is composed 

of two large RRM1 and two small RRM2 subunits in S phase and two large RRM1 and two alternative small p53R2 

subunits in non-dividing quiescent cells (PMID: 17416930).


What is the subcellular localization of RRM1?

RRM1 localizes to the cytoplasm, where it is responsible for dNTP production, forming a complex with RRM2. 

However, RRM1 can be recruited to DNA damage sites in the nucleus via interaction with Tip60 (PMID: 20159953).


What is the tissue expression pattern of RRM1?

RRM1 is ubiquitously expressed.


How is RRM1 expression regulated during the cell cycle and upon DNA damage?

Rrm1 gene expression levels depend on the cell cycle, and the highest mRNA levels are observed in S phase. 

However, RRM1 protein levels are constant throughout the cell cycle due to long protein half-life, contrary to 

RRM2, which is actively degraded after cell exit from S phase. During DNA damage, e.g., induced with genotoxins 

or UV light, expression of RRM1 and RRM2/p53R2 is upregulated (PMID: 1551913 and 8798592).


Protocols

Product Specific Protocols
FC protocol for CL Plus 488 RRM1 antibody CL488-10526Download protocol
IF protocol for CL Plus 488 RRM1 antibody CL488-10526Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...