RRM1 Monoclonal antibody, PBS Only

• 

  WB analysis of K-562 using 60073-2-Ig (same clone as 60073-2-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 60073-2-Ig (RRM1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 60073-2-Ig (same clone as 60073-2-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 60073-2-Ig (RRM1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 60073-2-Ig (same clone as 60073-2-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 60073-2-Ig (RRM1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 60073-2-Ig (same clone as 60073-2-PBS)

  IP result of anti-RRM1 (IP:60073-2-Ig, 5ug; Detection:60073-2-Ig 1:1000) with K-562 cells lysate 3440ug. This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 60073-2-Ig (same clone as 60073-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60073-2-Ig (RRM1 antibody) at dilution of 1:5000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 60073-2-Ig (same clone as 60073-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60073-2-Ig (RRM1 antibody) at dilution of 1:5000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 60073-2-Ig (same clone as 60073-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 60073-2-Ig (RRM1 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 60073-2-Ig (same clone as 60073-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 60073-2-Ig (RRM1 antibody) at dilution of 1:5000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 60073-2-Ig (same clone as 60073-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 60073-2-Ig (RRM1 antibody) at dilution of 1:5000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 60073-2-Ig (same clone as 60073-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 60073-2-Ig (RRM1 antibody) at dilution of 1:5000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 60073-2-Ig (same clone as 60073-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 60073-2-Ig (RRM1 antibody) at dilution of 1:5000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 60073-2-Ig (same clone as 60073-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60073-2-Ig (RRM1 antibody) at dilution of 1:5000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 60073-2-Ig (same clone as 60073-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60073-2-Ig (RRM1 antibody) at dilution of 1:5000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 60073-2-Ig (same clone as 60073-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 60073-2-Ig (RRM1 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 60073-2-Ig (same clone as 60073-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 60073-2-Ig (RRM1 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IF Staining of human breast cancer using 60073-2-Ig (same clone as 60073-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using RRM1 antibody (60073-2-Ig, Clone: 5H6F3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 60073-2-Ig (same clone as 60073-2-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using RRM1 antibody (60073-2-Ig, Clone: 5H6F3 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 60073-2-Ig (same clone as 60073-2-PBS)

  Immunofluorescent analysis of HeLa cells using 60073-2-Ig (RRM1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG (H+L). This data was developed using the same antibody clone with 60073-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RRM1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Cat No. 60073-2-PBS

Clone No.5H6F3

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Synonyms

RIR1, ribonucleotide reductase M1, Ribonucleoside-diphosphate reductase subunit M1, Ribonucleoside-diphosphate reductase large subunit, EC:1.17.4.1

---

Product Information

60073-2-PBS targets RRM1 in WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0789

  Product name: Recombinant human RRM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 593-792 aa of BC006498

  Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS

• Full Name: ribonucleotide reductase M1
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC006498
• Gene Symbol: RRM1
• Gene ID (NCBI): 6240
• RRID: AB_10597538
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23921
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ribonucleoside-diphosphate reductase functions as a heterodimer of a large and a small subunits in deoxyribonucleotide synthesis. RRM1 constitutes to the large subunit (R1) of ribonucleotide reductase, and it can either form heterodimer with small subunit RRM or RRM2B(PMID:16376858). RRM1 provides the precursors necessary for DNA synthesis. RRM1 can not be detected in quiescent cells, while its mRNA and protein are present throughout the cell cycle in cycling cells(PMID:8188248). Researches showed that RRM1 is involved in carcinogenesis, tumor progression, and the resistance of non-small-cell lung cancer (NSCLC) to treatment. Low level expression of RRM1 in NSCLC is associated with poor survival(PMID:17314339).