Tested Applications
Positive WB detected in | K-562 cells, HeLa cells |
Positive IP detected in | K-562 cells |
Positive IHC detected in | human breast cancer tissue, human colon cancer tissue, human lung cancer tissue, human pancreas cancer tissue, human urothelial carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human breast cancer tissue |
Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:3000-1:8000 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 4 publications below |
IHC | See 2 publications below |
IF | See 3 publications below |
IP | See 1 publications below |
Product Information
60073-2-Ig targets RRM1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0789 Product name: Recombinant human RRM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 593-792 aa of BC006498 Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS Predict reactive species |
Full Name | ribonucleotide reductase M1 |
Calculated Molecular Weight | 90 kDa |
Observed Molecular Weight | 90 kDa |
GenBank Accession Number | BC006498 |
Gene Symbol | RRM1 |
Gene ID (NCBI) | 6240 |
RRID | AB_10597538 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P23921 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ribonucleoside-diphosphate reductase functions as a heterodimer of a large and a small subunits in deoxyribonucleotide synthesis. RRM1 constitutes to the large subunit (R1) of ribonucleotide reductase, and it can either form heterodimer with small subunit RRM or RRM2B(PMID:16376858). RRM1 provides the precursors necessary for DNA synthesis. RRM1 can not be detected in quiescent cells, while its mRNA and protein are present throughout the cell cycle in cycling cells(PMID:8188248). Researches showed that RRM1 is involved in carcinogenesis, tumor progression, and the resistance of non-small-cell lung cancer (NSCLC) to treatment. Low level expression of RRM1 in NSCLC is associated with poor survival(PMID:17314339).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RRM1 antibody 60073-2-Ig | Download protocol |
IHC protocol for RRM1 antibody 60073-2-Ig | Download protocol |
IF protocol for RRM1 antibody 60073-2-Ig | Download protocol |
IP protocol for RRM1 antibody 60073-2-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Head Neck ATM, THMS and RRM1 protein expression in nasopharyngeal carcinomas (NPC) treated with curative intent. | ||
J Gastrointest Oncol Abrogation of ARF6 in promoting erastin-induced ferroptosis and mitigating capecitabine resistance in gastric cancer cells. | ||
Zhongguo Fei Ai Za Zhi [Prognostic Analysis of ERCC1, RRM1 and p53 Expressions in Postoperative Stage I-II Lung Cancer.]. | ||
Cell Death Discov Knockdown of RRM1 in tumor cells promotes radio-/chemotherapy induced ferroptosis by regulating p53 ubiquitination and p21-GPX4 signaling axis.
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Juan Pablo (Verified Customer) (11-29-2018) | Works great in WB. I treated CGN with shh (1ug/ml) to induce proliferation and I see a nice increase in RRM1 protein. You get a clean band around 90kDa.For Immuno works good at 1:100 dilution. Tested in P7 cerebellum
![]() |