Tested Applications
| Positive WB detected in | K-562 cells, HeLa cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human breast cancer tissue, human colon cancer tissue, human lung cancer tissue, human pancreas cancer tissue, human urothelial carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human breast cancer tissue |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:3000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 5 publications below |
| IHC | See 2 publications below |
| IF | See 3 publications below |
| IP | See 1 publications below |
Product Information
60073-2-Ig targets RRM1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0789 Product name: Recombinant human RRM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 593-792 aa of BC006498 Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS Predict reactive species |
| Full Name | ribonucleotide reductase M1 |
| Calculated Molecular Weight | 90 kDa |
| Observed Molecular Weight | 90 kDa |
| GenBank Accession Number | BC006498 |
| Gene Symbol | RRM1 |
| Gene ID (NCBI) | 6240 |
| RRID | AB_10597538 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P23921 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ribonucleoside-diphosphate reductase functions as a heterodimer of a large and a small subunits in deoxyribonucleotide synthesis. RRM1 constitutes to the large subunit (R1) of ribonucleotide reductase, and it can either form heterodimer with small subunit RRM or RRM2B(PMID:16376858). RRM1 provides the precursors necessary for DNA synthesis. RRM1 can not be detected in quiescent cells, while its mRNA and protein are present throughout the cell cycle in cycling cells(PMID:8188248). Researches showed that RRM1 is involved in carcinogenesis, tumor progression, and the resistance of non-small-cell lung cancer (NSCLC) to treatment. Low level expression of RRM1 in NSCLC is associated with poor survival(PMID:17314339).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RRM1 antibody 60073-2-Ig | Download protocol |
| IHC protocol for RRM1 antibody 60073-2-Ig | Download protocol |
| IP protocol for RRM1 antibody 60073-2-Ig | Download protocol |
| WB protocol for RRM1 antibody 60073-2-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Head Neck ATM, THMS and RRM1 protein expression in nasopharyngeal carcinomas (NPC) treated with curative intent. | ||
J Gastrointest Oncol Abrogation of ARF6 in promoting erastin-induced ferroptosis and mitigating capecitabine resistance in gastric cancer cells. | ||
Zhongguo Fei Ai Za Zhi [Prognostic Analysis of ERCC1, RRM1 and p53 Expressions in Postoperative Stage I-II Lung Cancer.]. | ||
Cell Death Discov Knockdown of RRM1 in tumor cells promotes radio-/chemotherapy induced ferroptosis by regulating p53 ubiquitination and p21-GPX4 signaling axis.
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Juan Pablo (Verified Customer) (11-29-2018) | Works great in WB. I treated CGN with shh (1ug/ml) to induce proliferation and I see a nice increase in RRM1 protein. You get a clean band around 90kDa.For Immuno works good at 1:100 dilution. Tested in P7 cerebellum
![]() |




































