Tested Applications
| Positive WB detected in | K-562 cells, HeLa cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human breast cancer tissue, human colon cancer tissue, human lung cancer tissue, human pancreas cancer tissue, human urothelial carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human breast cancer tissue |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:3000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60073-2-Ig targets RRM1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0789 Product name: Recombinant human RRM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 593-792 aa of BC006498 Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS Predict reactive species |
| Full Name | ribonucleotide reductase M1 |
| Calculated Molecular Weight | 90 kDa |
| Observed Molecular Weight | 90 kDa |
| GenBank Accession Number | BC006498 |
| Gene Symbol | RRM1 |
| Gene ID (NCBI) | 6240 |
| RRID | AB_10597538 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P23921 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ribonucleoside-diphosphate reductase functions as a heterodimer of a large and a small subunits in deoxyribonucleotide synthesis. RRM1 constitutes to the large subunit (R1) of ribonucleotide reductase, and it can either form heterodimer with small subunit RRM or RRM2B(PMID:16376858). RRM1 provides the precursors necessary for DNA synthesis. RRM1 can not be detected in quiescent cells, while its mRNA and protein are present throughout the cell cycle in cycling cells(PMID:8188248). Researches showed that RRM1 is involved in carcinogenesis, tumor progression, and the resistance of non-small-cell lung cancer (NSCLC) to treatment. Low level expression of RRM1 in NSCLC is associated with poor survival(PMID:17314339).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RRM1 antibody 60073-2-Ig | Download protocol |
| IHC protocol for RRM1 antibody 60073-2-Ig | Download protocol |
| IP protocol for RRM1 antibody 60073-2-Ig | Download protocol |
| WB protocol for RRM1 antibody 60073-2-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-RRM1 antibody (Cat# 60073-2-Ig) has 8 citations published in journals including Cell Death Discovery, EMBO Molecular Medicine, World Journal of Gastrointestinal Oncology, Head & Neck, Oncology Letters, Journal of Gastrointestinal Oncology, and Zhongguo Fei Ai Za Zhi. Research fields span ferroptosis, homologous recombination, radio/chemo-sensitivity, and ribonucleotide reductase biology, with applications in pancreatic, gastric, nasopharyngeal, and lung cancers.
| Species | Application | Title |
|---|---|---|
Cell Death Discov Knockdown of RRM1 in tumor cells promotes radio-/chemotherapy induced ferroptosis by regulating p53 ubiquitination and p21-GPX4 signaling axis.
| ||
Cell Death Discov RRM1 promotes homologous recombination and radio/chemo-sensitivity via enhancing USP11 and E2F1-mediated RAD51AP1 transcription
| ||
World J Gastrointest Oncol DEAD/H-box RNA helicase 10 promotes pancreatic cancer cell proliferation via ribonucleotide reductase M2 | ||
Head Neck ATM, THMS and RRM1 protein expression in nasopharyngeal carcinomas (NPC) treated with curative intent. | ||
J Gastrointest Oncol Abrogation of ARF6 in promoting erastin-induced ferroptosis and mitigating capecitabine resistance in gastric cancer cells. |
Reviews
What customers say
The single review rates this antibody 5 stars for Western Blot and Immunohistochemistry. In WB, the reviewer observed a clean band around 90 kDa in cerebellar granule neuron cultures treated with Shh to induce proliferation, confirming a clear increase in RRM1 protein. For IHC, the antibody performed well at a 1:100 dilution when tested on P7 cerebellum tissue. Overall, the reviewer found the antibody reliable and effective across both applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Juan Pablo (Verified Customer) (11-29-2018) | Works great in WB. I treated CGN with shh (1ug/ml) to induce proliferation and I see a nice increase in RRM1 protein. You get a clean band around 90kDa.For Immuno works good at 1:100 dilution. Tested in P7 cerebellum
 |
