Tested Applications
| Positive WB detected in | human heart tissue |
| Positive IHC detected in | human malignant melanoma tissue, human kidney tissue, human ovary tumor tissue, human appendicitis tissue, human tonsillitis tissue, rat brain tissue, human thyroid cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human ovary cancer tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
| IHC | See 1 publications below |
| IF | See 6 publications below |
Product Information
16027-1-AP targets S100A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8871 Product name: Recombinant human S100A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC014392 Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS Predict reactive species |
| Full Name | S100 calcium binding protein A1 |
| Calculated Molecular Weight | 94 aa, 11 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC014392 |
| Gene Symbol | S100A1 |
| Gene ID (NCBI) | 6271 |
| RRID | AB_2183214 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23297 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for S100A1 antibody 16027-1-AP | Download protocol |
| IHC protocol for S100A1 antibody 16027-1-AP | Download protocol |
| WB protocol for S100A1 antibody 16027-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biomaterials Biocompatibility and therapeutic efficacy of crosslinked hydrogel filled 3D-printed nerve conduit for sacral nerve injury repair | ||
Biomaterials Hydrogen-releasing electroactive nerve guidance conduits promote peripheral nerve regeneration by remodeling the microenvironment | ||
Biomaterials Oriented nanofibrous P(MMD-co-LA)/Deferoxamine nerve scaffold facilitates peripheral nerve regeneration by regulating macrophage phenotype and revascularization. | ||
Mol Neurobiol Anti-Apoptotic Effect of IGF1 on Schwann Exposed to Hyperglycemia is Mediated by Neuritin, a Novel Neurotrophic Factor. | ||
Front Pharmacol Reynoutrin Improves Ischemic Heart Failure in Rats Via Targeting S100A1.
| ||











































