S100A1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• S100A1 Polyclonal antibody (16027-1-AP)

• Featured Product
• KD/KO Validated

S100A1 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 16027-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

Protein S100 A1, Protein S100-A1, S 100 protein alpha chain, S 100 protein subunit alpha, S100 calcium-binding protein A1

• 

  WB analysis of human heart using 16027-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 16027-1-AP (S100A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 16027-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 16027-1-AP (S100A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human malignant melanoma using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:200 (under 10x lens)..

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human malignant melanoma using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:200 (under 40x lens)..

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16027-1-AP (S100A1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16027-1-AP (S100A1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 16027-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 16027-1-AP (S100A1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human ovary cancer using 16027-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human ovary cancer cells using 16027-1-AP (S100A1 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human ovary cancer using 16027-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human ovary cancer cells using 16027-1-AP (S100A1 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for S100A1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human heart tissue
• Positive IHC detected in: human malignant melanoma tissue, human kidney tissue, human ovary tumor tissue, human appendicitis tissue, human tonsillitis tissue, rat brain tissue, human thyroid cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human ovary cancer tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16027-1-AP targets S100A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8871

  Product name: Recombinant human S100A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-94 aa of BC014392

  Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

• Full Name: S100 calcium binding protein A1
• Calculated Molecular Weight: 94 aa, 11 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC014392
• Gene Symbol: S100A1
• Gene ID (NCBI): 6271
• RRID: AB_2183214
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23297
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100A1 belongs to the S100 protein family, which represents the largest group among EF-hand Ca2+-binding proteins exclusively expressed in vertebrates. S100 proteins have been described as central regulators of numerous cellular and molecular processes, often operating in a cell-type-specific manner (PMID: 11991838). S100A1 is a central regulator of Ca2+-driven networks that orchestrates compartmentalized Ca2+ fluxes in the heart (PMID: 22336719, PMID: 26021637). S100A1 is primarily expressed in cardiomyocytes (CM). Endothelial cells (EC) express significantly lower S100A1 levels, whereas fibroblasts do not express S100A1 (PMID: 38641766).

Publications

What published studies show

The S100A1 Polyclonal antibody (Cat# 16027-1-AP) has 14 citations. They appear in journals including Advanced Materials, Science Advances, Biomaterials, Cell Death & Disease, Acta Biomaterialia, Circulation: Heart Failure, Molecular Neurobiology, Frontiers in Pharmacology, Molecular Medicine Reports, and Translational Cancer Research. Research fields span peripheral nerve regeneration, dental stem cells, cochlear organoids, endometrial cancer, heart failure, and neuroinflammation.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Adv Mater; Photo-Responsive H2S Composite System Regulates the Nerve Regeneration Microenvironment Through Multiple Pathways; Authors - Yuanfang Huo
mouse	IF	Sci Adv; A spatially organized Cd24a+/Pax9+ stem cell core governs postnatal tooth establishment; Authors - Ce Shan
rat	IF	Sci Adv; An injectable and adaptable hydrogen sulfide delivery system for modulating neuroregenerative microenvironment; Authors - Xianzhen Dong
rat	IF	Biomaterials; Biocompatibility and therapeutic efficacy of crosslinked hydrogel filled 3D-printed nerve conduit for sacral nerve injury repair; Authors - Jiajia Lu
		Biomaterials; Hydrogen-releasing electroactive nerve guidance conduits promote peripheral nerve regeneration by remodeling the microenvironment; Authors - Zhiqiang Li
rat	IF	Biomaterials; Oriented nanofibrous P(MMD-co-LA)/Deferoxamine nerve scaffold facilitates peripheral nerve regeneration by regulating macrophage phenotype and revascularization.; Authors - Xianzhen Dong