S100A1 Monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• S100A1 Monoclonal antibody, PBS Only (Capture) (67237-1-PBS)

• 

  IHC staining of human tonsillitis using 67237-1-Ig (same clone as 67237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67237-1-Ig (S100A1 antibody) at dilution of 1:17000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67237-1-Ig (same clone as 67237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67237-1-Ig (S100A1 antibody) at dilution of 1:17000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 67237-1-Ig (same clone as 67237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67237-1-Ig (S100A1 antibody) at dilution of 1:17000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 67237-1-Ig (same clone as 67237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67237-1-Ig (S100A1 antibody) at dilution of 1:17000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67237-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP51090-1

  Cytometric bead array standard curve of MP51090-1, S100A1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67237-1-PBS. Detection antibody: 67237-2-PBS. Standard:Ag19544. Range: 3.125-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 67237-1-Ig

  Biolayer interferometry (BLl) kinetic assay of 67237-1-Ig against Human S100A1 was performed. The affinity constant is 7.37 nM.

S100A1 Monoclonal Antibody for IHC, Cytometric bead array, Indirect ELISA

Cat No. 67237-1-PBS

Clone No.1A8C1

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

IHC, Cytometric bead array, Indirect ELISA

Synonyms

1A8C1, Protein S100 A1, Protein S100-A1, S 100 protein alpha chain, S 100 protein subunit alpha

---

Product Information

67237-1-PBS targets S100A1 as part of a matched antibody pair:

MP51090-1: 67237-1-PBS capture and 67237-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19544

  Product name: Recombinant human S100A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-94 aa of BC014392

  Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

• Full Name: S100 calcium binding protein A1
• Calculated Molecular Weight: 94 aa, 11 kDa
• GenBank Accession Number: BC014392
• Gene Symbol: S100A1
• Gene ID (NCBI): 6271
• RRID: AB_3085037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P23297
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

S100A1 belongs to the S100 protein family, which represents the largest group among EF-hand Ca2+-binding proteins exclusively expressed in vertebrates. S100 proteins have been described as central regulators of numerous cellular and molecular processes, often operating in a cell-type-specific manner (PMID: 11991838). S100A1 is a central regulator of Ca2+-driven networks that orchestrates compartmentalized Ca2+ fluxes in the heart (PMID: 22336719, PMID: 26021637). S100A1 is primarily expressed in cardiomyocytes (CM). Endothelial cells (EC) express significantly lower S100A1 levels, whereas fibroblasts do not express S100A1 (PMID: 38641766).