Product Information
66227-1-PBS targets S100A10 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23596 Product name: Recombinant human S100A10 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-97 aa of BC015973 Sequence: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK Predict reactive species |
Full Name | S100 calcium binding protein A10 |
Calculated Molecular Weight | 11 kDa |
Observed Molecular Weight | 11 kDa |
GenBank Accession Number | BC015973 |
Gene Symbol | S100A10 |
Gene ID (NCBI) | 6281 |
RRID | AB_2881618 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P60903 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
S100A10, also known as p11, is a member of the S100 family of small, EF hand containing dimeric proteins. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A10 is present on the surface of endothelial and other cells in a heterotetrameric complex with another Ca(2+)-binding protein, annexin II. S100A10 may function in exocytosis and endocytosis.