S100A10 Monoclonal antibody

S100A10 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66227-1-Ig
Clone No.1B3F9

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

42C, ANX2L, ANX2LG, Ca[1], CAL1L, Calpactin 1 light chain, Calpactin I light chain, Cellular ligand of annexin II, CLP11, GP11, p10, p10 protein, P11, Protein S100 A10, S100A10

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman lung tissue
Positive IHC detected inhuman colon cancer tissue, human cervical cancer tissue, human liver cancer tissue, human stomach cancer tissue, human pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells, Saos-2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 2 publications below

Product Information

66227-1-Ig targets S100A10 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivitymouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23596

Product name: Recombinant human S100A10 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-97 aa of BC015973

Sequence: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Predict reactive species
Full Name S100 calcium binding protein A10
Calculated Molecular Weight 11 kDa
Observed Molecular Weight 11 kDa
GenBank Accession NumberBC015973
Gene Symbol S100A10
Gene ID (NCBI) 6281
RRIDAB_2881618
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP60903
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100A10, also known as p11, is a member of the S100 family of small, EF hand containing dimeric proteins. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A10 is present on the surface of endothelial and other cells in a heterotetrameric complex with another Ca(2+)-binding protein, annexin II. S100A10 may function in exocytosis and endocytosis.

Protocols

Product Specific Protocols
IF protocol for S100A10 antibody 66227-1-IgDownload protocol
IHC protocol for S100A10 antibody 66227-1-IgDownload protocol
WB protocol for S100A10 antibody 66227-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

NPJ Parkinsons Dis

Voluntary exercise alleviates neural functional deficits in Parkinson's disease mice by inhibiting microglial ferroptosis via SLC7A11/ALOX12 axis

Authors - Jinghui Xu
mouseIF

Exp Neurol

Voluntary wheel exercise improves glymphatic clearance and ameliorates colitis-associated cognitive impairment in aged mice by inhibiting TRPV4-induced astrocytic calcium activity

Authors - Mingyue Li
mouseIF

Adv Sci (Weinh)

MeCP2 Lactylation Protects against Ischemic Brain Injury by Transcriptionally Regulating Neuronal Apoptosis

Authors - Min Sun
Loading...
||
New chat Able
正在加载,请稍候...