Tested Applications
| Positive WB detected in | human lung tissue |
| Positive IHC detected in | human colon cancer tissue, human cervical cancer tissue, human liver cancer tissue, human pancreas cancer tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells, Saos-2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66227-1-Ig targets S100A10 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23596 Product name: Recombinant human S100A10 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-97 aa of BC015973 Sequence: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK Predict reactive species |
| Full Name | S100 calcium binding protein A10 |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC015973 |
| Gene Symbol | S100A10 |
| Gene ID (NCBI) | 6281 |
| RRID | AB_2881618 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P60903 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S100A10, also known as p11, is a member of the S100 family of small, EF hand containing dimeric proteins. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A10 is present on the surface of endothelial and other cells in a heterotetrameric complex with another Ca(2+)-binding protein, annexin II. S100A10 may function in exocytosis and endocytosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for S100A10 antibody 66227-1-Ig | Download protocol |
| IHC protocol for S100A10 antibody 66227-1-Ig | Download protocol |
| WB protocol for S100A10 antibody 66227-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The S100A10 Monoclonal antibody (1B3F9), catalog number 66227-1-Ig, has 7 cited publications. Citations appear in Redox Biology, Advanced Science, NPJ Parkinson's Disease, International Immunopharmacology, Experimental Neurology, and Research Square. Research fields include neuroinflammation, ferroptosis, ischemic brain injury, Parkinson's disease, astrocyte polarization, glymphatic clearance, Alzheimer's disease, and exercise-mediated neuroprotection. Applications cited are primarily IF and WB, with reactivity in mouse, rat, and human.
| Species | Application | Title |
|---|---|---|
Redox Biol A CoQ10 analog ameliorates cognitive impairment and early brain injury after subarachnoid hemorrhage by regulating ferroptosis and neuroinflammation | ||
Adv Sci (Weinh) MeCP2 Lactylation Protects against Ischemic Brain Injury by Transcriptionally Regulating Neuronal Apoptosis | ||
NPJ Parkinsons Dis Voluntary exercise alleviates neural functional deficits in Parkinson's disease mice by inhibiting microglial ferroptosis via SLC7A11/ALOX12 axis | ||
Int Immunopharmacol Lactate-mediated Ran lactylation at lysine 123 promotes astrocytes polarization after oxygen-glucose deprivation/reoxygenation. | ||
Exp Neurol Voluntary wheel exercise improves glymphatic clearance and ameliorates colitis-associated cognitive impairment in aged mice by inhibiting TRPV4-induced astrocytic calcium activity | ||
Exp Neurol Physical exercise protects neurons from energy deficit and improves cognitive function by upregulating astrocytic Slc2a1 in Alzheimer's disease. |
