Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

S100A4 Polyclonal antibody

S100A4 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

Cat No. 16105-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

Calvasculin, CAPL, Fibroblast Specific Protein, Fibroblast-specific protein 1, Fibroblast-specific protein-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, NIH/3T3 cells
Positive IP detected inA549 cells
Positive IHC detected inhuman breast cancer tissue, human pancreas cancer tissue, human colon cancer tissue, mouse spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse spleen tissue, mouse lung tissue
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16105-1-AP targets S100A4 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9019

Product name: Recombinant human S100A4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-101 aa of BC016300

Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Predict reactive species
Full Name S100 calcium binding protein A4
Calculated Molecular Weight 101 aa, 12 kDa
Observed Molecular Weight 10-12 kDa
GenBank Accession NumberBC016300
Gene Symbol S100A4
Gene ID (NCBI) 6275
ENSEMBL Gene IDENSG00000196154
RRIDAB_11042591
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP26447
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100A4 is a member of the S100 family of calcium-binding proteins. The S100 family members have been involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A4 is known to localize to and function in the nucleus, cytoplasm of cells, and the extracellular space. S100A4 has also been shown to be associated with tumor growth, motility, invasion, metastasis, angiogenesis, apoptosis, and chemoresistance. It is a fibroblast-specific protein associated with mesenchymal cell morphology and motility, is expressed during epithelial-mesenchymal transformations (EMT) in vivo (PMID: 9362334). It is a specific prognostic marker for renal survival in patients with IgAN (PMID: 16105038). It is also an improved marker for lung fibroblasts that could be useful for investigating the pathogenesis of pulmonary fibrosis(PMID: 15618458). Overexpression of S100A4 is correlated with a worse prognosis inpatients with various types of cancer.

Protocols

Product Specific Protocols
FC protocol for S100A4 antibody 16105-1-APDownload protocol
IF protocol for S100A4 antibody 16105-1-APDownload protocol
IHC protocol for S100A4 antibody 16105-1-APDownload protocol
IP protocol for S100A4 antibody 16105-1-APDownload protocol
WB protocol for S100A4 antibody 16105-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

Suppression of Enhancer Overactivation by a RACK7-Histone Demethylase Complex.

Authors - Hongjie Shen
  • KO Validated
humanIHC

J Hematol Oncol

Proteogenomic insights into the biology and treatment of pancreatic ductal adenocarcinoma

Authors - Yexin Tong
humanWB

Nat Commun

Co-evolution of matrisome and adaptive adhesion dynamics drives ovarian cancer chemoresistance.

Authors - Elina A Pietilä
mouseWB

ACS Appl Mater Interfaces

Smart Manganese Dioxide-Based Lanthanide Nanoprobes for Triple-Negative Breast Cancer Precise Gene Synergistic Chemodynamic Therapy.

Authors - Liyan Ming
humanWB,IF

Oncogene

Stromal nicotinamide N-methyltransferase orchestrates the crosstalk between fibroblasts and tumour cells in oral squamous cell carcinoma: evidence from patient-derived assembled organoids

Authors - Hui Zhao
humanIF

J Crohns Colitis

Exosomal miR-103a-3p from Crohn's creeping fat-derived ASCs contributes to intestinal fibrosis by targeting TGFBR3 and activating fibroblasts

Authors - Wenwei Qian

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marco (Verified Customer) (07-09-2024)

Does exactly what it should do in cardiac rat cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: NRVCMs
Loading...
||
New chat

Able

正在加载,请稍候...