CoraLite® Plus 488-conjugated S100A6 Monoclonal antibody

• 

  IF Staining of HepG2 using CL488-66098

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 S100A6 antibody (CL488-66098, Clone: 3D11C8 ) at dilution of 1:200.

• 

  IF Staining of SH-SY5Y using CL488-66098

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using CoraLite® Plus 488 S100A6 antibody (CL488-66098, Clone: 3D11C8 ) at dilution of 1:200.

S100A6 Monoclonal Antibody for IF/ICC

Cat No. CL488-66098

Clone No.3D11C8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC

Synonyms

2A9, 5B10, CABP, CACY, Calcyclin, MLN 4, PRA, Protein S100 A6, S100A6

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells, SH-SY5Y cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66098 targets S100A6 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17606

  Product name: Recombinant human S100A6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-90 aa of BC001431

  Sequence: MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

• Full Name: S100 calcium binding protein A6
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC001431
• Gene Symbol: S100A6
• Gene ID (NCBI): 6277
• RRID: AB_3084204
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P06703
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

S100A6 is also named as calcyclin, prolactin receptor-associated protein (PRA), growth factor-inducible protein 2A9 ir MLN4. It belongs to S100 family of low molecular weight, acidic, calcium-binding proteins which contain two EF-hand calcium binding sites. S100A6 may function as a calcium sensor to activate several processes in the calcium signal transduction pathway of cell growth, proliferation, secretion and exocytosis.