S100A9 Polyclonal antibody

• 

  WB analysis using 26992-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26992-1-AP (S100A9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 26992-1-AP

  WB result of S100A9 antibody (26992-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-S100A9 transfected MCF-7 cells.

• 

  IP experiment of MCF-7 using 26992-1-AP

  IP result of anti-S100A9 (IP:26992-1-AP, 4ug; Detection:26992-1-AP 1:3000) with MCF-7 cells lysate 1600 ug.

• 

  IHC staining of human breast cancer using 26992-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26992-1-AP (S100A9 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 26992-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26992-1-AP (S100A9 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 26992-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26992-1-AP (S100A9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 26992-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 26992-1-AP (S100A9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 26992-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 26992-1-AP (S100A9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 26992-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26992-1-AP (S100A9 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 26992-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26992-1-AP (S100A9 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 26992-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 26992-1-AP (S100A9 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 26992-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 26992-1-AP (S100A9 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 26992-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26992-1-AP (S100A9 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 26992-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26992-1-AP (S100A9 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 26992-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using S100A9 antibody (26992-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of A549 using 26992-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using S100A9 antibody (26992-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HepG2 using 26992-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using S100A9 antibody (26992-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

S100A9 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 26992-1-AP

Publications(66)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

CAGB, Calgranulin B, Calgranulin-B, Calprotectin L1H subunit, CFAG

---

Tested Applications

• Positive WB detected in: HL-60 cells, MCF-7 cells, THP-1 cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human breast cancer tissue, human liver cancer tissue, human oesophagus cancer tissue, human tonsillitis tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, A549 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 39 publications below
• IHC: See 14 publications below
• IF: See 18 publications below
• IP: See 4 publications below
• CoIP: See 2 publications below

Product Information

26992-1-AP targets S100A9 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25764

  Product name: Recombinant human S100A9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-114 aa of BC047681

  Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

• Full Name: S100 calcium binding protein A9
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC047681
• Gene Symbol: S100A9
• Gene ID (NCBI): 6280
• RRID: AB_2880716
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P06702
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer with an S100A8 partner (S100A8/A9), or as a heterotetramer with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Res; Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2.; Authors - Shaojun Zhang
human	WB	Cell Rep Med; Discovery of galectin-8 as an LILRB4 ligand driving M-MDSCs defines a class of antibodies to fight solid tumors; Authors - Yiting Wang
mouse		Sci Adv; Gut microbiota from patients with arteriosclerotic CSVD induces higher IL-17A production in neutrophils via activating RORγt.; Authors - Wei Cai
human	CoIP	Theranostics; Pancreatic ductal deletion of S100A9 alleviates acute pancreatitis by targeting VNN1-mediated ROS release to inhibit NLRP3 activation.; Authors - Hong Xiang ; KD Validated
mouse	WB,IHC	Theranostics; Hepatic RACK1 deficiency protects against fulminant hepatitis through myeloid-derived suppressor cells.; Authors - Genyu Liu
mouse	WB	Phytomedicine; Geniposide via enema alleviates colitis by modulating intestinal flora and bile acid metabolites, inhibiting S100A8/S100A9/NF-κB, and promoting TGR5 inhibition of NLRP3 inflammasome; Authors - Bao-Xin Zheng