CoraLite®594-conjugated S100A9 Polyclonal antibody

• 

  IF Staining of HeLa using CL594-26992

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite®594 S100A9 antibody (CL594-26992) at dilution of 1:200.

• 

  IF Staining of A549 using CL594-26992

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using CoraLite®594 S100A9 antibody (CL594-26992) at dilution of 1:200.

• 

  IF Staining of U2OS using CL594-26992

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using CoraLite®594 S100A9 antibody (CL594-26992) at dilution of 1:200.

• 

  FC experiment of HeLa using CL594-26992

  1x10^6 HeLa cells were intracellularly stained with 0.8 ug Coralite®594 S100a9 Polyclonal Antibody (CL594-26992)(red), or 0.8 ug CoraLite®594-conjugated Rabbit IgG control Rabbit PolyAb (CL594-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

S100A9 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-26992

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

CAGB, Calgranulin B, Calgranulin-B, Calprotectin L1H subunit, CFAG

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells, A549 cells, U2OS cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-26992 targets S100A9 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25764

  Product name: Recombinant human S100A9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-114 aa of BC047681

  Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

• Full Name: S100 calcium binding protein A9
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC047681
• Gene Symbol: S100A9
• Gene ID (NCBI): 6280
• RRID: AB_3673429
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P06702
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer with an S100A8 partner (S100A8/A9), or as a heterotetramer with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages.