Tested Applications
| Positive WB detected in | mouse brain tissue, A375 cells, U-251 cells, C6 cells, rat brain tissue |
| Positive IHC detected in | human malignant melanoma tissue, human appendicitis tissue, human gliomas tissue, mouse brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue, human malignant melanoma tissue, mouse cerebellum tissue, rat brain tissue |
| Positive IF-Fro detected in | mouse brain tissue |
| Positive IF/ICC detected in | human astrocytes, A375 cells |
| Positive FC (Intra) detected in | A375 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:4000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:6000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 30 publications below |
| IHC | See 35 publications below |
| IF | See 91 publications below |
| ELISA | See 1 publications below |
Product Information
15146-1-AP targets S100B in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7440 Product name: Recombinant human S100B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC001766 Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE Predict reactive species |
| Full Name | S100 calcium binding protein B |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC001766 |
| Gene Symbol | S100 Beta |
| Gene ID (NCBI) | 6285 |
| RRID | AB_2254244 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04271 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S100B belongs to the EF-hand calcium binding proteins and is found primarily in astrocytes in the central nervous system (CNS). S100B has a variety of functions, including calcium homeostasis, cell proliferation, differentiation, migration, and survival, as well as neurite outgrowth and regeneration.
1. What is the molecular weight of S100B?
S100B protein is composed of non-covalently linked homodimers of 11 kDa size.
2. What is the subcellular localization of S100B?
S100B localizes to the nucleus and cytoplasm, associating with intracellular membranes, the centrosomes, microtubules, and type III intermediate filaments (PMID: 19110011). Additionally, it can be released from astrocytes into the extracellular space and can enter the bloodstream.
3. What is the expression pattern of S100B?
S100B is predominantly expressed in astrocytes and maturing oligodendrocytes but is also present in other cell types such as kidney epithelial cells, neural progenitor cells, pituicytes, ependymocytes, chondrocytes, adipocytes, melanocytes, Langerhans cells, dendritic cells, certain lymphocyte subpopulations, skeletal myofibers, myoblasts, and muscle satellite cells (PMID: 19110011). S100B is a commonly used marker of Schwann cells and reactive astrocytes in ICC, IHC, and WB applications.
4. What is the diagnostic use of S100B in the clinic?
S100B is naturally secreted by astrocytes into the extracellular space and low amounts of S100B can pass through the brain-blood barrier and enter the bloodstream. Elevated levels of S100B in the serum are observed in patients with traumatic head injuries, as well as in patients suffering from neurodegenerative diseases (PMID: 30144068). This increase in S100B levels is attributed to the elevated secretion of S100B protein from astrocytes as part of the physiological response to the injury, as well as to the physical damage of astrocytes and increased blood-brain barrier permeability.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for S100B antibody 15146-1-AP | Download protocol |
| IF protocol for S100B antibody 15146-1-AP | Download protocol |
| IHC protocol for S100B antibody 15146-1-AP | Download protocol |
| WB protocol for S100B antibody 15146-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Mechanoreceptor synapses in the brainstem shape the central representation of touch. | ||
Sci Bull (Beijing) Restoring sweat gland function in mice using regenerative sweat gland cells derived from chemically reprogrammed human epidermal keratinocytes | ||
Nat Commun Alk1 acts in non-endothelial VE-cadherin+ perineurial cells to maintain nerve branching during hair homeostasis | ||
Neuron γ-Protocadherins control synapse formation and peripheral branching of touch sensory neurons |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Audrey (Verified Customer) (04-17-2026) | Works well for IF
|
FH Xiaohuan (Verified Customer) (01-30-2026) | S100B Polyclonal antibody, it is very less exclusive to label astrocytes
|
FH Xiaohuan (Verified Customer) (11-06-2025) |
|
FH Clarisse (Verified Customer) (08-08-2022) | This antibody works very well as an astrocyte marker. In the image: in green mouse anti-S100B (1:500 - 66616-1-Ig) and in magenta rabbit anti-S100B (1:500 - 15146-1-AP). The rabbit antibody has a better performance.
![]() |
FH Tongcheng (Verified Customer) (09-08-2021) | This antibody works perfect on human astrocytes.
|
FH Sonia (Verified Customer) (10-21-2019) | Works really well on mouse sciatic nerve cross section (cryostat)
![]() |



























































