S100B Polyclonal antibody, PBS Only

• 

  WB analysis using 15146-1-AP (same clone as 15146-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15146-1-AP (S100B antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15146-1-AP (same clone as 15146-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15146-1-AP (S100 beta antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15146-1-AP (same clone as 15146-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15146-1-AP (S100 beta antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 15146-1-AP (same clone as 15146-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 15146-1-AP (S100 beta antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-251 using 15146-1-AP (same clone as 15146-1-PBS)

  U-251 cells were subjected to SDS PAGE followed by western blot with 15146-1-AP (S100 beta antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human malignant melanoma using 15146-1-AP (same clone as 15146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 15146-1-AP (S100 Beta antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human malignant melanoma using 15146-1-AP (same clone as 15146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 15146-1-AP (S100 Beta antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 15146-1-AP (same clone as 15146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 15146-1-AP (S100 Beta antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 15146-1-AP (same clone as 15146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 15146-1-AP (S100 Beta antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 15146-1-AP (same clone as 15146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 15146-1-AP (S100 Beta antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 15146-1-AP (same clone as 15146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 15146-1-AP (S100B antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 15146-1-AP (same clone as 15146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 15146-1-AP (S100B antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 15146-1-AP (same clone as 15146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 15146-1-AP (S100B antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 15146-1-AP (same clone as 15146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 15146-1-AP (S100B antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15146-1-AP (same clone as 15146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15146-1-AP (S100 Beta antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15146-1-AP (same clone as 15146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15146-1-AP (S100 Beta antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 15146-1-AP (same clone as 15146-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using S100 Beta antibody (15146-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 15146-1-AP (same clone as 15146-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using S100 Beta antibody (15146-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 15146-1-AP (same clone as 15146-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using S100 Beta antibody (15146-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 15146-1-AP (same clone as 15146-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using S100 Beta antibody (15146-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 15146-1-AP (same clone as 15146-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using S100B antibody (15146-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 15146-1-AP (same clone as 15146-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using S100B antibody (15146-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 15146-1-AP (same clone as 15146-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using S100B antibody (15146-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human malignant melanoma using 15146-1-AP (same clone as 15146-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human malignant melanoma tissue using S100 Beta antibody (15146-1-AP) at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human malignant melanoma using 15146-1-AP (same clone as 15146-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human malignant melanoma tissue using S100 Beta antibody (15146-1-AP) at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human astrocytes using 15146-1-AP (same clone as 15146-1-PBS)

  Immunofluorescence analysis of human pluripotent stem cell-derived astrocytes with S100β (15146-1-AP) at 1/200 (Magenta) and neurons with TUJ1 (66375-1-Ig) at 1:500 (Green). The sample was fixed with 4% Paraformaldehyde and permeabilized with 0.3% Triton X-100. Alexa Fluor 488-conjugated goat anti-mouse IgG (1/500) and Alexa Fluor 594-conjugated goat anti-rabbit IgG (1/500) were used as the secondary antibodies. Nuclei were counterstained with DAPI (blue). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A375 using 15146-1-AP (same clone as 15146-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed A375 cells using 15146-1-AP (S100 beta antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A375 using 15146-1-AP (same clone as 15146-1-PBS)

  1X10^6 A375 cells were intracellularly stained with 0.5 ug Anti-Human S100 Beta (15146-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.5 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 15146-1-PBS in a different storage buffer formulation.

S100B Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Cat No. 15146-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Synonyms

S100 beta, Protein S100 B, Protein S100-B, S100 calcium-binding protein B, S-100 protein beta chain

---

Product Information

15146-1-PBS targets S100B in WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7440

  Product name: Recombinant human S100B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-92 aa of BC001766

  Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

• Full Name: S100 calcium binding protein B
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC001766
• Gene Symbol: S100 Beta
• Gene ID (NCBI): 6285
• RRID: AB_2254244
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04271
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

S100B belongs to the EF-hand calcium binding proteins and is found primarily in astrocytes in the central nervous system (CNS). S100B has a variety of functions, including calcium homeostasis, cell proliferation, differentiation, migration, and survival, as well as neurite outgrowth and regeneration.

 1. What is the molecular weight of S100B?

S100B protein is composed of non-covalently linked homodimers of 11 kDa size.

2. What is the subcellular localization of S100B?

S100B localizes to the nucleus and cytoplasm, associating with intracellular membranes, the centrosomes, microtubules, and type III intermediate filaments (PMID: 19110011). Additionally, it can be released from astrocytes into the extracellular space and can enter the bloodstream.

3. What is the expression pattern of S100B?

S100B is predominantly expressed in astrocytes and maturing oligodendrocytes but is also present in other cell types such as kidney epithelial cells, neural progenitor cells, pituicytes, ependymocytes, chondrocytes, adipocytes, melanocytes, Langerhans cells, dendritic cells, certain lymphocyte subpopulations, skeletal myofibers, myoblasts, and muscle satellite cells (PMID: 19110011). S100B is a commonly used marker of Schwann cells and reactive astrocytes in ICC, IHC, and WB applications.

4. What is the diagnostic use of S100B in the clinic?

S100B is naturally secreted by astrocytes into the extracellular space and low amounts of S100B can pass through the brain-blood barrier and enter the bloodstream. Elevated levels of S100B in the serum are observed in patients with traumatic head injuries, as well as in patients suffering from neurodegenerative diseases (PMID: 30144068). This increase in S100B levels is attributed to the elevated secretion of S100B protein from astrocytes as part of the physiological response to the injury, as well as to the physical damage of astrocytes and increased blood-brain barrier permeability.