Use Able AI chat for product recommendations

S100B Polyclonal antibody, PBS Only

S100B Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), Indirect ELISA

Cat No. 15146-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), Indirect ELISA

S100 beta, Protein S100 B, Protein S100-B, S100 calcium-binding protein B, S-100 protein beta chain

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

15146-1-PBS targets S100B in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7440

Product name: Recombinant human S100B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-92 aa of BC001766

Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Predict reactive species
Full Name S100 calcium binding protein B
Calculated Molecular Weight 11 kDa
Observed Molecular Weight 11 kDa
GenBank Accession NumberBC001766
Gene Symbol S100 Beta
Gene ID (NCBI) 6285
RRIDAB_2254244
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04271
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

S100B belongs to the EF-hand calcium binding proteins and is found primarily in astrocytes in the central nervous system (CNS). S100B has a variety of functions, including calcium homeostasis, cell proliferation, differentiation, migration, and survival, as well as neurite outgrowth and regeneration.

 1. What is the molecular weight of S100B?

S100B protein is composed of non-covalently linked homodimers of 11 kDa size.

2. What is the subcellular localization of S100B?

S100B localizes to the nucleus and cytoplasm, associating with intracellular membranes, the centrosomes, microtubules, and type III intermediate filaments (PMID: 19110011). Additionally, it can be released from astrocytes into the extracellular space and can enter the bloodstream.

3. What is the expression pattern of S100B?

S100B is predominantly expressed in astrocytes and maturing oligodendrocytes but is also present in other cell types such as kidney epithelial cells, neural progenitor cells, pituicytes, ependymocytes, chondrocytes, adipocytes, melanocytes, Langerhans cells, dendritic cells, certain lymphocyte subpopulations, skeletal myofibers, myoblasts, and muscle satellite cells (PMID: 19110011). S100B is a commonly used marker of Schwann cells and reactive astrocytes in ICC, IHC, and WB applications.

4. What is the diagnostic use of S100B in the clinic?

S100B is naturally secreted by astrocytes into the extracellular space and low amounts of S100B can pass through the brain-blood barrier and enter the bloodstream. Elevated levels of S100B in the serum are observed in patients with traumatic head injuries, as well as in patients suffering from neurodegenerative diseases (PMID: 30144068). This increase in S100B levels is attributed to the elevated secretion of S100B protein from astrocytes as part of the physiological response to the injury, as well as to the physical damage of astrocytes and increased blood-brain barrier permeability.


Loading...
||
New chat

Able

正在加载,请稍候...