Product Information
85972-2-PBS targets S100A8 as part of a matched antibody pair:
MP02237-1: 85972-2-PBS capture and 85972-1-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2959 Product name: Recombinant Mouse S100A8 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 2-89 aa of NM_013650.2 Sequence: PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE Predict reactive species |
| Full Name | S100 calcium binding protein A8 (calgranulin A) |
| Calculated Molecular Weight | 10 kDa |
| GenBank Accession Number | NM_013650.2 |
| Gene Symbol | S100a8 |
| Gene ID (NCBI) | 20201 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P27005 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



