Sars-cov-2 SARS-COV-2 NSP12 Polyclonal antibody, PBS Only

• 

  ELISA experiment of Recombinant protein using 29264-1-AP (same clone as 29264-1-PBS)

  SARS-CoV-2 Envelope protein Antibody (29264-1-AP) tested by ELISA. SARS-COV-2 NSP12 protein was coated onto microtiter plates at 1 µg/well and then incubated with a dilution series of SARS-COV-2 NSP12 protein Antibody (29264-1-AP). Bound antibodies were detected with HRP conjugated anti-Rabbit IgG followed by incubation with HRP Substrate and then measuring the resulting absorbance at 450 nm. This data was developed using the same antibody clone with 29264-1-PBS in a different storage buffer formulation.

• 

  ELISA experiment using 29264-1-AP (same clone as 29264-1-PBS)

  SARS-CoV-2 Envelope protein Antibody (29264-1-AP) tested by ELISA. SARS-COV-2 NSP12 protein was coated onto microtiter plates at 1 µg/well and then incubated with a dilution series of SARS-COV-2 NSP12 protein Antibody (29264-1-AP). Bound antibodies were detected with HRP conjugated anti-Rabbit IgG followed by incubation with HRP Substrate and then measuring the resulting absorbance at 450 nm. This data was developed using the same antibody clone with 29264-1-PBS in a different storage buffer formulation.

SARS-COV-2 NSP12 Polyclonal Antibody for ELISA, Indirect ELISA

Cat No. 29264-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

virus

Applications

ELISA, Indirect ELISA

Synonyms

---

Product Information

29264-1-PBS targets SARS-COV-2 NSP12 in ELISA, Indirect ELISA applications and shows reactivity with virus samples.

• Tested Reactivity: virus
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30931

  Product name: Recombinant sars-cov-2 NSP12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of YP_009725307

  Sequence: SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAG

• Full Name: ORF1ab
• GenBank Accession Number: YP_009725307
• Gene Symbol: SARS-COV-2 NSP8
• Gene ID (NCBI): 43740578
• RRID: AB_2918262
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.