Use Able AI chat for product recommendations

SDHB Recombinant monoclonal antibody

SDHB Uni-rAb® Recombinant Antibody for WB, IHC, ELISA

Cat No. 87791-1-RR
Clone No.253361D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

EC:1.3.5.1, Iron-sulfur subunit of complex II, PGL 4, PGL4, SDH

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HSC-T6 cells, HeLa cells, HEK-293 cells, K-562 cells, NIH/3T3 cells, Neuro-2a cells
Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

87791-1-RR targets SDHB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0968

Product name: Recombinant human SDHB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-280 aa of BC007840

Sequence: MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV

Predict reactive species
Full Name succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Calculated Molecular Weight 32 kDa
Observed Molecular Weight 28-32 kDa
GenBank Accession NumberBC007840
Gene Symbol SDHB
Gene ID (NCBI) 6390
RRIDAB_3745752
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21912
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SDHB(Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial) is also named as SDH, SDH1 and belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family. The SDHD, SDHB, and SDHC genes encode subunits of mitochondrial complex II (succinate dehydrogenase). Mitochondrial complex II is a heterotetrameric complex involved in the aerobic electron transport chain and catalyses the oxidation of succinate to fumarate (Krebs cycle) with transport of electrons to the ubiquinone pool. SDHA and SDHB are the hydrophilic catalytic part of the complex and are highly conserved(J Med Genet 2004;41:e99). Defects in SDHB are a cause of susceptibility to pheochromocytoma (PCC), paragangliomas type 4 (PGL4), paraganglioma and gastric stromal sarcoma (PGGSS) and Cowden-like syndrome (CWDLS).

Protocols

Product Specific Protocols
IHC protocol for SDHB antibody 87791-1-RRDownload protocol
WB protocol for SDHB antibody 87791-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...