Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, L02 cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human liver tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse pancreas tissue |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 14 publications below |
| IHC | See 3 publications below |
| IF | See 7 publications below |
| IP | See 1 publications below |
Product Information
15087-1-AP targets SEC61B in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7169 Product name: Recombinant human SEC61B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC001734 Sequence: MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS Predict reactive species |
| Full Name | Sec61 beta subunit |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 10-15 kDa |
| GenBank Accession Number | BC001734 |
| Gene Symbol | SEC61B |
| Gene ID (NCBI) | 10952 |
| RRID | AB_2186411 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P60468 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The heteromeric SEC61 complex is composed of alpha, beta and gamma subunits. Oligomers of the SEC61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane (PMID: 10212142). SEC61B is the beta subunit of the SEC61 complex. It has been reported that SEC61B facilitates cotranslational protein transport and interacts with the signal peptidase during translocation (PMID: 9585408).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SEC61B antibody 15087-1-AP | Download protocol |
| IHC protocol for SEC61B antibody 15087-1-AP | Download protocol |
| IP protocol for SEC61B antibody 15087-1-AP | Download protocol |
| WB protocol for SEC61B antibody 15087-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Science QRICH1 dictates the outcome of ER stress through transcriptional control of proteostasis. | ||
Nat Neurosci Faulty autolysosome acidification in Alzheimer's disease mouse models induces autophagic build-up of Aβ in neurons, yielding senile plaques. | ||
J Cell Biol Forcible destruction of severely misfolded mammalian glycoproteins by the non-glycoprotein ERAD pathway. | ||
Genes Dev Identification of a localized nonsense-mediated decay pathway at the endoplasmic reticulum. | ||
Cell Rep NEMF-mediated Listerin-independent mitochondrial translational surveillance by E3 ligase Pirh2 and mitochondrial protease ClpXP |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Wei (Verified Customer) (09-22-2020) | SEC61B Antibody have correct localization on ER.
|
FH WEI (Verified Customer) (06-29-2020) | Strong band for heart tissues, but not so sharp band.
|























