Use Able AI chat for product recommendations
  • KD/KO Validated

SEC61B Polyclonal antibody

SEC61B Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

Protein transport protein Sec61 subunit beta

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for SEC61B in ?

Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, HepG2 cells, L02 cells, mouse liver tissue, rat liver tissue
Positive IP detected inHepG2 cells
Positive IHC detected inhuman liver tissue, human cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse pancreas tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15087-1-AP targets SEC61B in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7169

Product name: Recombinant human SEC61B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-96 aa of BC001734

Sequence: MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS

Predict reactive species
Full Name Sec61 beta subunit
Calculated Molecular Weight 10 kDa
Observed Molecular Weight 10-15 kDa
GenBank Accession NumberBC001734
Gene Symbol SEC61B
Gene ID (NCBI) 10952
RRIDAB_2186411
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP60468
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The heteromeric SEC61 complex is composed of alpha, beta and gamma subunits. Oligomers of the SEC61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane (PMID: 10212142). SEC61B is the beta subunit of the SEC61 complex. It has been reported that SEC61B facilitates cotranslational protein transport and interacts with the signal peptidase during translocation (PMID: 9585408).

Protocols

Product Specific Protocols
IF protocol for SEC61B antibody 15087-1-APDownload protocol
IHC protocol for SEC61B antibody 15087-1-APDownload protocol
IP protocol for SEC61B antibody 15087-1-APDownload protocol
WB protocol for SEC61B antibody 15087-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SEC61B Polyclonal Antibody (Cat# 15087-1-AP) has 28 citations across 23 journals including Science, Nature Cell Biology, Nature Neuroscience, Nature Communications, Molecular Cell, and Cell Reports. Research fields span ER stress, ER-phagy, protein translocation, lipid droplet homeostasis, Alzheimer's disease, dilated cardiomyopathy, STING-mediated innate immunity, autophagy, mitochondrial quality control, and endosomal trafficking.

SpeciesApplicationTitle
humanIF

Signal Transduct Target Ther

Targeting intracellular cholesterol imbalance rescues sarcomere-ER contact site signaling and ER remodeling in dilated cardiomyopathy.

Authors - Nadezda Ignatyeva
humanWB

Science

QRICH1 dictates the outcome of ER stress through transcriptional control of proteostasis.

Authors - Kwontae You
human, mouse, ratWB

Nat Cell Biol

Cholesterol sensing by the SCAP-FAM134B complex regulates ER-phagy and STING innate immunity.

Authors - Boran Li
mouseWB

Nat Neurosci

Faulty autolysosome acidification in Alzheimer's disease mouse models induces autophagic build-up of Aβ in neurons, yielding senile plaques.

Authors - Ju-Hyun Lee
humanIF

Nat Commun

SigmaR1 is an auxiliary translocon factor with lipid-binding activity that regulates protein and lipid droplet homeostasis.

Authors - Xuewen Hu

Nat Commun

Sec14L6 is a phosphoinositide transporter that regulates phosphoinositide homeostasis and biogenesis of lipid droplets

Authors - Tiantian Zhou

Reviews

    4.0 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers (Wei Feng) rated the antibody 4/5 and tested it on mouse heart tissue. For immunofluorescence, the antibody showed correct localization on the ER. For Western blot, it produced a strong band in heart tissues, though the band was noted as not being very sharp. Overall, the antibody performed well for its intended applications with minor limitations in band resolution on WB.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Wei (Verified Customer) (09-22-2020)

SEC61B Antibody have correct localization on ER.

  • Applications: Immunofluorescence
  • Cell Tissue Type: Mouse heart

WEI (Verified Customer) (06-29-2020)

Strong band for heart tissues, but not so sharp band.

  • Applications: Western Blot,
  • Cell Tissue Type: Mouse heart
Loading...
||
New chat

Able™

正在加载,请稍候...