Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, L02 cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human liver tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse pancreas tissue |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15087-1-AP targets SEC61B in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7169 Product name: Recombinant human SEC61B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC001734 Sequence: MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS Predict reactive species |
| Full Name | Sec61 beta subunit |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 10-15 kDa |
| GenBank Accession Number | BC001734 |
| Gene Symbol | SEC61B |
| Gene ID (NCBI) | 10952 |
| RRID | AB_2186411 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P60468 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The heteromeric SEC61 complex is composed of alpha, beta and gamma subunits. Oligomers of the SEC61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane (PMID: 10212142). SEC61B is the beta subunit of the SEC61 complex. It has been reported that SEC61B facilitates cotranslational protein transport and interacts with the signal peptidase during translocation (PMID: 9585408).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SEC61B antibody 15087-1-AP | Download protocol |
| IHC protocol for SEC61B antibody 15087-1-AP | Download protocol |
| IP protocol for SEC61B antibody 15087-1-AP | Download protocol |
| WB protocol for SEC61B antibody 15087-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
SEC61B Polyclonal Antibody (Cat# 15087-1-AP) has 28 citations across 23 journals including Science, Nature Cell Biology, Nature Neuroscience, Nature Communications, Molecular Cell, and Cell Reports. Research fields span ER stress, ER-phagy, protein translocation, lipid droplet homeostasis, Alzheimer's disease, dilated cardiomyopathy, STING-mediated innate immunity, autophagy, mitochondrial quality control, and endosomal trafficking.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Targeting intracellular cholesterol imbalance rescues sarcomere-ER contact site signaling and ER remodeling in dilated cardiomyopathy. | ||
Science QRICH1 dictates the outcome of ER stress through transcriptional control of proteostasis. | ||
Nat Cell Biol Cholesterol sensing by the SCAP-FAM134B complex regulates ER-phagy and STING innate immunity. | ||
Nat Neurosci Faulty autolysosome acidification in Alzheimer's disease mouse models induces autophagic build-up of Aβ in neurons, yielding senile plaques. | ||
Nat Commun SigmaR1 is an auxiliary translocon factor with lipid-binding activity that regulates protein and lipid droplet homeostasis. | ||
Nat Commun Sec14L6 is a phosphoinositide transporter that regulates phosphoinositide homeostasis and biogenesis of lipid droplets |
Reviews
What customers say
Both reviewers (Wei Feng) rated the antibody 4/5 and tested it on mouse heart tissue. For immunofluorescence, the antibody showed correct localization on the ER. For Western blot, it produced a strong band in heart tissues, though the band was noted as not being very sharp. Overall, the antibody performed well for its intended applications with minor limitations in band resolution on WB.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Wei (Verified Customer) (09-22-2020) | SEC61B Antibody have correct localization on ER.
|
WEI (Verified Customer) (06-29-2020) | Strong band for heart tissues, but not so sharp band.
|
