CoraLite® Plus 488-conjugated SEC61B Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-15087

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 SEC61B antibody (CL488-15087) at dilution of 1:200.

SEC61B Polyclonal Antibody for IF/ICC

Cat No. CL488-15087

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

Sec61 beta subunit, SEC61B

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15087 targets SEC61B in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7169

  Product name: Recombinant human SEC61B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-96 aa of BC001734

  Sequence: MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS

• Full Name: Sec61 beta subunit
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10-15 kDa
• GenBank Accession Number: BC001734
• Gene Symbol: SEC61B
• Gene ID (NCBI): 10952
• RRID: AB_3672621
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P60468
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The heteromeric SEC61 complex is composed of alpha, beta and gamma subunits. Oligomers of the SEC61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane (PMID: 10212142). SEC61B is the beta subunit of the SEC61 complex. It has been reported that SEC61B facilitates cotranslational protein transport and interacts with the signal peptidase during translocation (PMID: 9585408).