SEC62 Polyclonal antibody

• 

  WB analysis using 28693-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28693-1-AP (SEC62 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 28693-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 28693-1-AP (SEC62 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 28693-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using SEC62 antibody (28693-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

SEC62 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 28693-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Translocation protein SEC62, hTP-1, SEC 62, TP-1, Translocation protein 1

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HT-29 cells, SW480 cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

28693-1-AP targets SEC62 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29932

  Product name: Recombinant human SEC62 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-183 aa of NM_003262

  Sequence: MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKEEDKKSKKENIKDEKTKKEKEKKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLDGNE

• Full Name: SEC62 homolog (S. cerevisiae)
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: NM_003262
• Gene Symbol: SEC62
• Gene ID (NCBI): 7095
• RRID: AB_3086078
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99442
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SEC62 is a integral endoplasmic reticulum (ER) membrane protein. SEC62 and SEC63 form a dimeric complex and play a central role in translocation of nascent and newly synthesized precursor polypeptides into the ER. SEC62 is associated with poor prognosis in a variety of tumors, such as prostate cancer, hepatocellular cancer, breast cancer , melanoma, colorectal cancer (PMID: 36262254).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Phytomedicine; Cinobufagin overcomes bortezomib resistance in multiple myeloma strains by targeting SEC62/TRPM4-mediated NECSO; Authors - Zhao Yin
human	WB	EMBO J; ER-phagy restrains inflammatory responses through its receptor UBAC2; Authors - Xing He