SEMA3A Polyclonal antibody

• 

  WB analysis using 27836-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27836-1-AP (SEMA3A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 27836-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SEMA3A antibody (27836-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

SEMA3A Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 27836-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (3)

Applications

WB, IF/ICC, CoIP, ELISA

Synonyms

coll 1, Hsema I, Hsema III, Sema III, SEMA1, SEMA3A, SEMAD, SEMAIII, SEMAL, Semaphorin 3A, Semaphorin III, SemD

---

Tested Applications

• Positive WB detected in: PC-12 cells, SH-SY5Y cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

27836-1-AP targets SEMA3A in WB, IF/ICC, CoIP, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27173

  Product name: Recombinant human SEMA3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 140-235 aa of BC111416

  Sequence: ICTYIEIGHHPEDNIFKLENSHFENGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPKFISAHLISES

• Full Name: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A
• Calculated Molecular Weight: 771 aa, 89 kDa
• Observed Molecular Weight: 89 and 65 kDa
• GenBank Accession Number: BC111416
• Gene Symbol: SEMA3A
• Gene ID (NCBI): 10371
• RRID: AB_2880989
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14563
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SEMA3A (Semaphorin 3A), a class-3 semaphorin signaling protein, is involved in cell signaling with PlexinA1 and Neuropilin-1 (NRP1) receptors and it is responsible for recruiting dendritic cells into lymphatics. It's widely expressed in different tissues (PMID:10766232). SEMA3A has been shown to exert osteoprotective effects, characterized by increasing bone formation while inhibiting the activation of osteoclast precursor cells (PMID:36598593). However, SEMA3A also modulates the immune system. SEMA3A expression in a myocardial infarct area enhances macrophage polarization and inhibits monocyte migration into the lesion area (PMID:28540528).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Periodontal Res; Semaphorin 3A attenuates the hypoxia suppression of osteogenesis in periodontal ligament stem cells.; Authors - Xiaochi Chang
human	WB	J Orthop Surg Res; Exosomes promote hFOB1.19 proliferation and differentiation via LINC00520; Authors - Jin Wu
rat	WB	Neurosci Lett; TsMS combined with EA promotes functional recovery and axonal regeneration via mediating the miR-539-5p/Sema3A/PlexinA1 signalling axis in sciatic nerve-injured rats; Authors - Xianbin Wang
mouse	WB,IF,CoIP	Sci Adv; Selective promotion of sensory innervation-mediated immunoregulation for tissue repair; Authors - Kaicheng Xu
human	WB	Cell Biochem Biophys; Sema3A Modified PDLSCs Exhibited Enhanced Osteogenic Capabilities and Stimulated Differentiation of Pre-Osteoblasts; Authors - Wen Wang