Tested Applications
| Positive WB detected in | PC-12 cells, SH-SY5Y cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
27836-1-AP targets SEMA3A in WB, IF/ICC, CoIP, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27173 Product name: Recombinant human SEMA3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 140-235 aa of BC111416 Sequence: ICTYIEIGHHPEDNIFKLENSHFENGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPKFISAHLISES Predict reactive species |
| Full Name | sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A |
| Calculated Molecular Weight | 771 aa, 89 kDa |
| Observed Molecular Weight | 89 and 65 kDa |
| GenBank Accession Number | BC111416 |
| Gene Symbol | SEMA3A |
| Gene ID (NCBI) | 10371 |
| RRID | AB_2880989 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14563 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SEMA3A (Semaphorin 3A), a class-3 semaphorin signaling protein, is involved in cell signaling with PlexinA1 and Neuropilin-1 (NRP1) receptors and it is responsible for recruiting dendritic cells into lymphatics. It's widely expressed in different tissues (PMID:10766232). SEMA3A has been shown to exert osteoprotective effects, characterized by increasing bone formation while inhibiting the activation of osteoclast precursor cells (PMID:36598593). However, SEMA3A also modulates the immune system. SEMA3A expression in a myocardial infarct area enhances macrophage polarization and inhibits monocyte migration into the lesion area (PMID:28540528).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SEMA3A antibody 27836-1-AP | Download protocol |
| WB protocol for SEMA3A antibody 27836-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Periodontal Res Semaphorin 3A attenuates the hypoxia suppression of osteogenesis in periodontal ligament stem cells. | ||
J Orthop Surg Res Exosomes promote hFOB1.19 proliferation and differentiation via LINC00520 | ||
Neurosci Lett TsMS combined with EA promotes functional recovery and axonal regeneration via mediating the miR-539-5p/Sema3A/PlexinA1 signalling axis in sciatic nerve-injured rats | ||
Cell Biochem Biophys Sema3A Modified PDLSCs Exhibited Enhanced Osteogenic Capabilities and Stimulated Differentiation of Pre-Osteoblasts | ||
Sci Adv Selective promotion of sensory innervation-mediated immunoregulation for tissue repair |



