SEMA3A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SEMA3A Polyclonal antibody (27836-1-AP)

SEMA3A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27836-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

coll 1, Hsema I, Hsema III, Sema III, SEMA1

• 

  WB analysis using 27836-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27836-1-AP (SEMA3A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 27836-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27836-1-AP (SEMA3A antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 27836-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SEMA3A antibody (27836-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SEMA3A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: PC-12 cells, SH-SY5Y cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27836-1-AP targets SEMA3A in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27173

  Product name: Recombinant human SEMA3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 140-235 aa of BC111416

  Sequence: ICTYIEIGHHPEDNIFKLENSHFENGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPKFISAHLISES

• Full Name: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A
• Calculated Molecular Weight: 771 aa, 89 kDa
• Observed Molecular Weight: 89 and 65 kDa
• GenBank Accession Number: BC111416
• Gene Symbol: SEMA3A
• Gene ID (NCBI): 10371
• RRID: AB_2880989
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14563
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SEMA3A (Semaphorin 3A), a class-3 semaphorin signaling protein, is involved in cell signaling with PlexinA1 and Neuropilin-1 (NRP1) receptors and it is responsible for recruiting dendritic cells into lymphatics. It's widely expressed in different tissues (PMID:10766232). SEMA3A has been shown to exert osteoprotective effects, characterized by increasing bone formation while inhibiting the activation of osteoclast precursor cells (PMID:36598593). However, SEMA3A also modulates the immune system. SEMA3A expression in a myocardial infarct area enhances macrophage polarization and inhibits monocyte migration into the lesion area (PMID:28540528).

Publications

What published studies show

The Sema3A antibody (Cat# 27836-1-AP) has 8 total citations spanning journals including Science Advances, Free Radical Biology and Medicine, International Immunopharmacology, Journal of Periodontal Research, Journal of Orthopaedic Surgery and Research, Cell Biochemistry and Biophysics, PLoS One, and Neuroscience Letters. Research fields cover sensory innervation-mediated immunoregulation, glioblastoma progression, bone healing, osteogenesis, exosome biology, osteoporosis, and peripheral nerve injury repair.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF,CoIP	Sci Adv; Selective promotion of sensory innervation-mediated immunoregulation for tissue repair; Authors - Kaicheng Xu
human		Free Radic Biol Med; HIC2 suppresses glioblastoma progression via transcriptional repression of SEMA3A and inhibition of TGF-β signaling; Authors - Liang Zhang
		Int Immunopharmacol; Sensory nerve-derived semaphorin 3A promotes bone healing through macrophage immunomodulation.; Authors - Yixuan Jiang
human	WB	J Periodontal Res; Semaphorin 3A attenuates the hypoxia suppression of osteogenesis in periodontal ligament stem cells.; Authors - Xiaochi Chang
human	WB	J Orthop Surg Res; Exosomes promote hFOB1.19 proliferation and differentiation via LINC00520; Authors - Jin Wu
human	WB	Cell Biochem Biophys; Sema3A Modified PDLSCs Exhibited Enhanced Osteogenic Capabilities and Stimulated Differentiation of Pre-Osteoblasts; Authors - Wen Wang