SEPT3 Polyclonal antibody

SEPT3 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA
Cat No. 30146-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), IP, ELISA

bK250D10.3, Neuronal specific septin 3, Neuronal-specific septin-3, SEP3, septin 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse brain tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30146-1-AP targets SEPT3 in WB, IHC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32890

Product name: Recombinant human SEPT3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 264-345 aa of BC111779

Sequence: VLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE

Predict reactive species
Full Name septin 3
Calculated Molecular Weight 358 aa, 41 kDa
Observed Molecular Weight40 kDa
GenBank Accession NumberBC111779
Gene Symbol SEPT3
Gene ID (NCBI) 55964
RRIDAB_2935520
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UH03
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SEPT3 is a developmentally regulated phosphoprotein. SEPT3 is a member of the septin GTPase family, which can form polymers and contribute to the cytoskeleton. SEPT3 is involved in neuronal autophagy. In the process of autophagy regulation, the level of SEPT3 will change according to the autophagy protein. SEPT3 is specifically expressed in the brain (PMID: 15485489; 35932293).

Protocols

Product Specific Protocols
FC protocol for SEPT3 antibody 30146-1-APDownload protocol
IHC protocol for SEPT3 antibody 30146-1-APDownload protocol
IP protocol for SEPT3 antibody 30146-1-APDownload protocol
WB protocol for SEPT3 antibody 30146-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...