Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30146-1-AP targets SEPT3 in WB, IHC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32890 Product name: Recombinant human SEPT3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 264-345 aa of BC111779 Sequence: VLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE Predict reactive species |
| Full Name | septin 3 |
| Calculated Molecular Weight | 358 aa, 41 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | BC111779 |
| Gene Symbol | SEPT3 |
| Gene ID (NCBI) | 55964 |
| RRID | AB_2935520 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UH03 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SEPT3 is a developmentally regulated phosphoprotein. SEPT3 is a member of the septin GTPase family, which can form polymers and contribute to the cytoskeleton. SEPT3 is involved in neuronal autophagy. In the process of autophagy regulation, the level of SEPT3 will change according to the autophagy protein. SEPT3 is specifically expressed in the brain (PMID: 15485489; 35932293).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SEPT3 antibody 30146-1-AP | Download protocol |
| IHC protocol for SEPT3 antibody 30146-1-AP | Download protocol |
| IP protocol for SEPT3 antibody 30146-1-AP | Download protocol |
| WB protocol for SEPT3 antibody 30146-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









