SERP1 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 17807-1-AP (same clone as 17807-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17807-1-AP (SERP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17807-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 17807-1-AP (same clone as 17807-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 17807-1-AP (SERP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17807-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 17807-1-AP (same clone as 17807-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 17807-1-AP (SERP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17807-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 17807-1-AP (same clone as 17807-1-PBS)

  IP result of anti-SERP1 (IP:17807-1-AP, 4ug; Detection:17807-1-AP 1:500) with mouse brain tissue lysate 3160 ug. This data was developed using the same antibody clone with 17807-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 17807-1-AP (same clone as 17807-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 17807-1-AP (SERP1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17807-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 17807-1-AP (same clone as 17807-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 17807-1-AP (SERP1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17807-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 17807-1-AP (same clone as 17807-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SERP1 antibody (17807-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 17807-1-PBS in a different storage buffer formulation.

SERP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 17807-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

RAMP4, Ribosome-attached membrane protein 4, Stress-associated endoplasmic reticulum protein 1

---

Product Information

17807-1-PBS targets SERP1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12087

  Product name: Recombinant human SERP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-66 aa of BC108314

  Sequence: MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM

• Full Name: stress-associated endoplasmic reticulum protein 1
• Calculated Molecular Weight: 66 aa, 7 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC108314
• Gene Symbol: SERP1
• Gene ID (NCBI): 27230
• RRID: AB_10597394
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6X1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Stress-associated endoplasmic reticulum (ER) protein 1 (SERP1), also known as ribosome- associated membrane protein 4 (RAMP4), is a Sec61-associated polypeptide that is induced by ER stress [PMID:16705175]. SERP1 interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. It controls glycosylation of major histocompatibility complex class II-associated invariant chains by a translocational pausing mechanism, and its overexpression stabilizes newly synthesized membrane proteins under ER stress by associating with the Sec61 complex [PMID:10601334]. It is suggested SERP1 is involved in the biosynthesis/processing of secretory proteins