• Featured Product
  • KD/KO Validated

Alpha-1-Antitrypsin Polyclonal antibody

Alpha-1-Antitrypsin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

Cat No. 16382-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

a1-antitrypsin, Serpin A1, SERPINA1, A1A, A-1-Antitrypsin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, human kidney tissue, human placenta tissue, human urine sample, mouse liver tissue, mouse lung tissue, mouse skin tissue, HepG2 cells, mouse kidney tissue, human saliva
Positive IP detected inmouse kidney tissue
Positive IHC detected inmouse liver tissue, human colon tissue, human liver cancer tissue, mouse kidney tissue, rat kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse liver tissue
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16382-1-AP targets Alpha-1-Antitrypsin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9369

Product name: Recombinant human Alpha-1-Antitrypsin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 28-418 aa of BC015642

Sequence: QGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQATTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

Predict reactive species
Full Name serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Calculated Molecular Weight 418 aa, 47 kDa
Observed Molecular Weight 47-51 kDa
GenBank Accession NumberBC015642
Gene Symbol Alpha 1-Antitrypsin
Gene ID (NCBI) 5265
RRIDAB_10641185
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01009
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SERPINA1 is the gene for a protein called alpha-1-antitrypsin (AAT), which is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. AAT is a glycoprotein synthesized primarily by hepatocytes, with smaller amountssynthesized by intestinal epithelial cells, neutrophils, pulmonary alveolar cells and macrophages. AAT is the most abundant, endogenous serine protease inhibitor in blood circulation and it has been implicated in regulating vital fluid phase biological events such as blood coagulation, fibrinolysis, complement activation, apoptosis, reproduction, tumor progression and inflammatory response. The primary function of AAT is thought to be the inactivation of neutrophil elastase and other endogenous serine proteases. Defects in SERPINA1 can cause emphysema or liver disease. Alpha 1 Antitrypsin has two bands (PMID: 36703990, PMID: 26869867).

Protocols

Product Specific Protocols
FC protocol for Alpha-1-Antitrypsin antibody 16382-1-APDownload protocol
IF protocol for Alpha-1-Antitrypsin antibody 16382-1-APDownload protocol
IHC protocol for Alpha-1-Antitrypsin antibody 16382-1-APDownload protocol
IP protocol for Alpha-1-Antitrypsin antibody 16382-1-APDownload protocol
WB protocol for Alpha-1-Antitrypsin antibody 16382-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

Neutrophil elastase selectively kills cancer cells and attenuates tumorigenesis.

Authors - Chang Cui
humanWB

Nat Commun

Alpha-1 antitrypsin inhibits TMPRSS2 protease activity and SARS-CoV-2 infection.

Authors - Lukas Wettstein
mouseWB

Nat Commun

The RNA-binding protein vigilin regulates VLDL secretion through modulation of Apob mRNA translation.

Authors - Mehrpouya B Mobin
humanIF

Matrix Biol

Proteome-wide and matrisome-specific atlas of the human ovary computes fertility biomarker candidates and open the way for precision oncofertility.

Authors - Emna Ouni
humanIF

Int J Mol Sci

Vesicular Integral-Membrane Protein 36 Is Involved in the Selective Secretion of Fucosylated Proteins into Bile Duct-like Structures in HepG2 Cells

Authors - Mizuki Muranaka
humanWB

J Nutr Biochem

Characterization of dietary and herbal sourced natural compounds that modulate SEL1L-HRD1 ERAD activity and alleviate protein misfolding in the ER

Authors - Jifeng Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Claudia (Verified Customer) (02-05-2026)

Western blot in Hep40 cells using the AAT antibody It works well, a single well defined band is observed. *The first line is the kaleidoscope biorad protein ladder

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:50000
  • Cell Tissue Type: Hep40
Alpha-1-Antitrypsin Antibody Western Blot validation (1:50000 dilution) in Hep40 (Cat no:16382-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...