SETD5 Polyclonal antibody, PBS Only

• 

  WB analysis using 28434-1-AP (same clone as 28434-1-PBS)

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 28434-1-AP (SETD5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28434-1-PBS in a different storage buffer formulation.

• 

  IP experiment of BxPC-3 using 28434-1-AP (same clone as 28434-1-PBS)

  IP result of anti-SETD5 (IP:28434-1-AP, 4ug; Detection:28434-1-AP 1:600) with BxPC-3 cells lysate 2360 ug. This data was developed using the same antibody clone with 28434-1-PBS in a different storage buffer formulation.

SETD5 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 28434-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

KIAA1757, Histone-lysine N-methyltransferase SETD5

---

Product Information

28434-1-PBS targets SETD5 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28920

  Product name: Recombinant human SETD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-202 aa of BC020956

  Sequence: MHAFENLEKRKKRRDQPLEQSNSDVEITTTTSETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQANAQQAELSQAALEEGGSNSLVTPTEAGSLDSSGENRPLTGSDPTVVSITGSHVNRAASKYPKTKKYLVTEWLNDKAEKQECPVE

• Full Name: SET domain containing 5
• Observed Molecular Weight: 160-220 kDa
• GenBank Accession Number: BC020956
• Gene Symbol: SETD5
• Gene ID (NCBI): 55209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C0A6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SETD5, also known as KIAA1757, is a member of the histone lysine methyltransferase family. It has 3 isoforms and is involved in a variety of cellular functions, including cell cycle regulation and cell proliferation, and has a potential role in early embryonic development (PMID: 36875494).