Tested Applications
| Positive WB detected in | HeLa cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:9000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12929-2-AP targets ASF/SF2 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3626 Product name: Recombinant human ASF/SF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-248 aa of BC010264 Sequence: MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT Predict reactive species |
| Full Name | splicing factor, arginine/serine-rich 1 |
| Calculated Molecular Weight | 248 aa, 28 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC010264 |
| Gene Symbol | ASF/SF2 |
| Gene ID (NCBI) | 6426 |
| RRID | AB_2187211 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q07955 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SFRS1, also named as ASF, SF2, SF2P33, SFRS1 and ASF-1, belongs to the splicing factor SR family. It plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. SFRS1 interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Isoform ASF-2 and isoform ASF-3 act as splicing repressors. This antibody can recognize all the 3 isoforms(28kd,33kd and 22kd) of SFRS1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ASF/SF2 antibody 12929-2-AP | Download protocol |
| IHC protocol for ASF/SF2 antibody 12929-2-AP | Download protocol |
| IP protocol for ASF/SF2 antibody 12929-2-AP | Download protocol |
| WB protocol for ASF/SF2 antibody 12929-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ASF/SF2 Polyclonal antibody (Cat# 12929-2-AP) has 55 citations spanning journals including Science, Nature Communications, Molecular Cell, Cancer Research, Oncogene, Cell Reports, Nucleic Acids Research, Journal of Biological Chemistry, Molecular Cancer, and Theranostics. Research fields cover alternative splicing, RNA biology, oncology (hepatocellular, gastric, breast, lung, and colorectal cancers), cardiovascular disease, pulmonary fibrosis, neurodegeneration, and reproductive biology, with applications predominantly in Western blot, IF, RIP, and IP.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Activation of Nerve Growth Factor signaling limits the response to lenvatinib in hepatocellular carcinoma | ||
Mol Cancer Inhibition of PRMT5 triggers synthetic lethality in ARID1A-deficient endometrial cancer by promoting aberrant R-loop accumulation. | ||
Cancer Res CircFOXK2 Promotes Growth and Metastasis of Pancreatic Ductal Adenocarcinoma by Complexing with RNA Binding Proteins and Sponging MiR-942. | ||
Nat Commun Mutually exclusive acetylation and ubiquitylation of the splicing factor SRSF5 control tumor growth. | ||
Mol Cell LncRNA-splicing factor condensates regulate hypoxia-responsive pre-mRNA processing near nuclear speckles. |
Reviews
What customers say
Users report consistent performance across applications. One reviewer found it proficient for identifying SRSF1 by immunofluorescence at 1:1000 in K562 cells. Another noted clean Western blot results with a single band at 1:1000, and successful IF at 1:50 in EL4 cells and primary murine CD4 T cells. A third reviewer confirmed strong nuclear signal in human osteosarcoma cells at 1:100 for IF. Overall, the antibody delivers clear, specific results in both WB and IF with favorable ratings.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Rahul (Verified Customer) (07-23-2025) | Proficient in identifying SRSF1 using IF
 |
Katie (Verified Customer) (03-14-2022) | Works well for western blot - clean blot with one band.
|
Yan (Verified Customer) (04-28-2021) | It worked very well when I performed immunofluorescence. Signal was observed in the nucleus.
|
