Tested Applications
Positive WB detected in | HeLa cells, mouse brain tissue, rat brain tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:9000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 5 publications below |
WB | See 32 publications below |
IHC | See 2 publications below |
IF | See 10 publications below |
IP | See 3 publications below |
CoIP | See 2 publications below |
RIP | See 8 publications below |
Product Information
12929-2-AP targets ASF/SF2 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3626 Product name: Recombinant human ASF/SF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-248 aa of BC010264 Sequence: MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT Predict reactive species |
Full Name | splicing factor, arginine/serine-rich 1 |
Calculated Molecular Weight | 248 aa, 28 kDa |
Observed Molecular Weight | 28 kDa |
GenBank Accession Number | BC010264 |
Gene Symbol | ASF/SF2 |
Gene ID (NCBI) | 6426 |
RRID | AB_2187211 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q07955 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SFRS1, also named as ASF, SF2, SF2P33, SFRS1 and ASF-1, belongs to the splicing factor SR family. It plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. SFRS1 interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Isoform ASF-2 and isoform ASF-3 act as splicing repressors. This antibody can recognize all the 3 isoforms(28kd,33kd and 22kd) of SFRS1.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for ASF/SF2 antibody 12929-2-AP | Download protocol |
IHC protocol for ASF/SF2 antibody 12929-2-AP | Download protocol |
IP protocol for ASF/SF2 antibody 12929-2-AP | Download protocol |
WB protocol for ASF/SF2 antibody 12929-2-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Cell Zc3h13 Regulates Nuclear RNA m6A Methylation and Mouse Embryonic Stem Cell Self-Renewal. | ||
Nat Commun Mutually exclusive acetylation and ubiquitylation of the splicing factor SRSF5 control tumor growth. | ||
Nucleic Acids Res Sequence-dependent recruitment of SRSF1 and SRSF7 to intronless lncRNA NKILA promotes nuclear export via the TREX/TAP pathway. | ||
Cell Death Differ The long non-coding RNA PFI protects against pulmonary fibrosis by interacting with splicing regulator SRSF1. | ||
Angiogenesis Extracellular matrix stiffness controls VEGF165 secretion and neuroblastoma angiogenesis via the YAP/RUNX2/SRSF1 axis. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Rahul (Verified Customer) (07-23-2025) | Proficient in identifying SRSF1 using IF
![]() |
FH Katie (Verified Customer) (03-14-2022) | Works well for western blot - clean blot with one band.
|
FH Yan (Verified Customer) (04-28-2021) | It worked very well when I performed immunofluorescence. Signal was observed in the nucleus.
|