Tested Applications
Positive WB detected in | A549 cells, HEK-293 cells, HeLa cells, K-562 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21212-1-AP targets SFRS2 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15612 Product name: Recombinant human SFRS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC070086 Sequence: MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRY Predict reactive species |
Full Name | splicing factor, arginine/serine-rich 2 |
Calculated Molecular Weight | 221 aa, 25 kDa |
Observed Molecular Weight | 30-35 kDa |
GenBank Accession Number | BC070086 |
Gene Symbol | SFRS2 |
Gene ID (NCBI) | 6427 |
RRID | AB_3085645 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q01130 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SFRS2, also named as PR264 and SC-35, belongs to the splicing factor SR family. SFRS2 is necessary for the splicing of pre-mRNA. It is required for formation of the earliest ATP-dependent splicing complex and interacts with spliceosomal components bound to both the 5'- and 3'-splice sites during spliceosome assembly. It also is required for ATP-dependent interactions of both U1 and U2 snRNPs with pre-mRNA. It binds to purine-rich RNA sequences, either 5'-AGSAGAGTA-3' (S=C or G) or 5'-GTTCGAGTA-3'. SFRS2 can bind to beta-globin mRNA and commit it to the splicing pathway. The antibody has no cross reaction to SFRS2B.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SFRS2 antibody 21212-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |