Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, MCF-7 cells, MDA-MB-231 cells, mouse liver tissue, rat liver tissue |
| Positive IHC detected in | mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29752-1-AP targets SHH in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31338 Product name: Recombinant human SHH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 23-123 aa of NM_000193 Sequence: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRV Predict reactive species |
| Full Name | sonic hedgehog homolog (Drosophila) |
| Calculated Molecular Weight | 50 kDa |
| Observed Molecular Weight | 50-60 kDa |
| GenBank Accession Number | NM_000193 |
| Gene Symbol | SHH |
| Gene ID (NCBI) | 6469 |
| RRID | AB_2935475 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15465 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SHH, Sonic hedgehog protein, binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (PMID: 10753901). In the absence of SHH, PTCH1 represses the constitutive signaling activity of SMO (PMID: 10753901). SHH is synthesized as a 45 kDa precursor that undergoes an autocatalytic processing event that produces a 19 kDa N-terminal product, responsible for all signaling activities, and a 25 kDa C-terminal fragment (PMID: 10753901, PMID: 16282375).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SHH antibody 29752-1-AP | Download protocol |
| IHC protocol for SHH antibody 29752-1-AP | Download protocol |
| WB protocol for SHH antibody 29752-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









