SHH Polyclonal antibody

SHH Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 29752-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

HPE3, HLP3, HHG-1, HHG1, HHG 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, MCF-7 cells, MDA-MB-231 cells, mouse liver tissue, rat liver tissue
Positive IHC detected inmouse embryo tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29752-1-AP targets SHH in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31338

Product name: Recombinant human SHH protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 23-123 aa of NM_000193

Sequence: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRV

Predict reactive species
Full Name sonic hedgehog homolog (Drosophila)
Calculated Molecular Weight 50 kDa
Observed Molecular Weight50-60 kDa
GenBank Accession NumberNM_000193
Gene Symbol SHH
Gene ID (NCBI) 6469
RRIDAB_2935475
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15465
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SHH, Sonic hedgehog protein, binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (PMID: 10753901). In the absence of SHH, PTCH1 represses the constitutive signaling activity of SMO (PMID: 10753901). SHH is synthesized as a 45 kDa precursor that undergoes an autocatalytic processing event that produces a 19 kDa N-terminal product, responsible for all signaling activities, and a 25 kDa C-terminal fragment (PMID: 10753901, PMID: 16282375).

Protocols

Product Specific Protocols
WB protocol for SHH antibody 29752-1-APDownload protocol
IHC protocol for SHH antibody 29752-1-APDownload protocol
FC protocol for SHH antibody 29752-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...